3UV5: Transcription initiation factor TFIID subunit 1

Name: PDB 3UV5: Crystal Structure of the tandem bromodomains of human Transcription initiation factor TFIID subunit 1 (TAF1)
Published: 2012-01-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal Structure of the tandem bromodomains of human Transcription initiation factor TFIID subunit 1 (TAF1). Determined by X-ray diffraction at 2.03 Å resolution. Released 18 Jan 2012.

Method: X-ray diffraction
Resolution: 2.03 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,334
Mol. weight: 31.09 kDa
Released: 18 Jan 2012

Explore 3UV5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UV5 contains 16 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	1402-1418	17
α-helix	1424-1426	3
α-helix	1429-1431	3
α-helix	1438-1441	4
α-helix	1448-1456	9
α-helix	1463-1481	19
α-helix	1486-1504	19
α-helix	1506-1516	11
α-helix	1523-1534	12
α-helix	1535-1540	6
α-helix	1547-1549	3
α-helix	1561-1564	4
α-helix	1571-1579	9
α-helix	1586-1603	18
α-helix	1609-1627	19
α-helix	1629-1651	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor TFIID subunit 1	A	protein	265	Homo sapiens	P21675 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3UV5_1 Transcription initiation factor TFIID subunit 1 (chains A)
SMSIHRRRTDPMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTL
RENVRKRLYPSREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLAR
LEKAINPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDL
ETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEH
LTQLEKDICTAKEAALEEAELESLD

Primary citation

Histone recognition and large-scale structural analysis of the human bromodomain family. Filippakopoulos, P., Picaud, S., Mangos, M. et al. Cell (2012) 149:214-231. DOI 10.1016/j.cell.2012.02.013 · PubMed

Other PDB entries of the same protein (UniProt P21675 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5I29 1.21 Å, TAF1(2) bound to a pyrrolopyridone compound
7LB1 1.35 Å, Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ZS1-585
4YYM 1.5 Å, Crystal structure of TAF1 BD2 Bromodomain bound to a butyryllysine peptide
5I1Q 1.5 Å, Second bromodomain of TAF1 bound to a pyrrolopyridone compound
7K27 1.5 Å, Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ATR…
7JJG 1.6 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to ATR kinase…
7K03 1.6 Å, Crystal structure of the tandem bromodomain (BD1 and BD2) of human TAF1 bound to ATR…
7T36 1.65 Å, Crystal structure of the tandem bromodomain (BD1 and BD2) of human TAF1 bound to ZS1-322
7JSP 1.7 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to ATR kinase…
7K3O 1.7 Å, Crystal structure of the unliganded second bromodomain (BD2) of human TAF1
7K42 1.7 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to dioxane
7LB2 1.7 Å, Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ZS1-589

Browse structure collections

About this viewer

MolViewer shows 3UV5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.