3UXG: RFXANK

Crystal structure of RFXANK. Determined by X-ray diffraction at 1.85 Å resolution. Released 13 Jun 2012.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,499
Mol. weight: 20.7 kDa
Released: 13 Jun 2012

Explore 3UXG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UXG contains 13 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	94-99	6
α-helix	103-109	7
α-helix	115-118	4
α-helix	127-133	7
α-helix	137-146	10
α-helix	160-166	7
α-helix	170-177	8
α-helix	185-187	3
α-helix	193-199	7
α-helix	203-211	9
α-helix	226-233	8
α-helix	236-248	13

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	346-349	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-binding protein RFXANK	A	protein	172	Homo sapiens	O14593 (AlphaFold model)
Histone deacetylase 4	B	protein	17	Homo sapiens	P56524 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3UXG_1 DNA-binding protein RFXANK (chains A)
GDSLSIHQLAAQGELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETVRFLLEWGA
DPHILAKERESALSLASTGGYTDIVGLLLERDVDINIYDWNGGTPLLYAVHGNHVKCVEA
LLARGADLTTEADSGYTPMDLAVALGYRKVQQVIENHILKLFQSNLVPADPE

Sequence of entity 2 (B), FASTA

>3UXG_2 Histone deacetylase 4 (chains B)
LPLYTSPSLPNITLGLP

Primary citation

Sequence-Specific Recognition of a PxLPxI/L Motif by an Ankyrin Repeat Tumbler Lock. Xu, C., Jin, J., Bian, C. et al. Sci Signal (2012) 5:ra39-ra39. DOI 10.1126/scisignal.2002979 · PubMed

Other PDB entries of the same protein (UniProt O14593 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3V30 1.57 Å, Crystal Structure of the Peptide Bound Complex of the Ankyrin Repeat Domains of Human…
6MEW 1.78 Å, RFXANK ankyrin repeats in complex with a RFX7 peptide

Browse structure collections

About this viewer

MolViewer shows 3UXG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.