Structure of the C13.18 RNA Aptamer in Complex with G Protein-Coupled Receptor Kinase 2. Determined by X-ray diffraction at 3.51 Å resolution. Released 11 Jul 2012.
Explore 3UZT in 3D Show helices and sheets RCSB PDB PDBe
3UZT contains 29 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 39-49 | 11 | |
| α-helix | 55-60 | 6 | |
| α-helix | 62-72 | 11 | |
| α-helix | 80-93 | 14 | |
| α-helix | 98-108 | 11 | |
| α-helix | 109-114 | 6 | |
| α-helix | 126-137 | 12 | |
| α-helix | 147-156 | 10 | |
| α-helix | 157-161 | 5 | |
| α-helix | 162-166 | 5 | |
| α-helix | 169-182 | 14 | |
| β-strand | 191-196 | 6 | 1 |
| β-strand | 200 | 1 | 2 |
| β-strand | 203 | 1 | 2 |
| β-strand | 204-210 | 7 | 1 |
| β-strand | 216-223 | 8 | 1 |
| α-helix | 224-229 | 6 | |
| α-helix | 233-246 | 14 | |
| β-strand | 254 | 1 | 3 |
| β-strand | 257-262 | 6 | 1 |
| β-strand | 266-272 | 7 | 1 |
| β-strand | 278 | 1 | 3 |
| α-helix | 279-286 | 8 | |
| α-helix | 289-290 | 2 | |
| α-helix | 291-310 | 20 | |
| β-strand | 313-314 | 2 | 4 |
| β-strand | 323-325 | 3 | 3 |
| β-strand | 331-333 | 3 | 3 |
| β-strand | 340-341 | 2 | 4 |
| α-helix | 354-356 | 3 | |
| α-helix | 371-385 | 15 | |
| α-helix | 419-428 | 10 | |
| α-helix | 444-448 | 5 | |
| α-helix | 451-453 | 3 | |
| α-helix | 458-463 | 6 | |
| α-helix | 467-468 | 2 | |
| α-helix | 471-473 | 3 | |
| α-helix | 502-506 | 5 | |
| β-strand | 512 | 1 | 1 |
| α-helix | 514-522 | 9 | |
| α-helix | 526-544 | 19 | |
| β-strand | 561-565 | 5 | 5 |
| β-strand | 579-583 | 5 | 5 |
| β-strand | 588-591 | 4 | 5 |
| β-strand | 599 | 1 | 5 |
| α-helix | 603-605 | 3 | |
| β-strand | 606-610 | 5 | 6 |
| β-strand | 619-624 | 6 | 6 |
| β-strand | 629-633 | 5 | 6 |
| β-strand | 634 | 1 | 5 |
| α-helix | 637-654 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beta-adrenergic receptor kinase 1 | A | protein | 689 | Bos taurus | P21146 (AlphaFold model) |
| C13.18 RNA Aptamer | B | RNA | 18 |
>3UZT_1 Beta-adrenergic receptor kinase 1 (chains A) MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFS QKLGYLLFRDFCLKHLEEAKPLVEFYEEIKKYEKLETEEERLVCSREIFDTYIMKELLAC SHPFSKSAIEHVQGHLVKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNV ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE LRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAA DAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARK KTKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSL LTMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCDSDPELVQWKKELRDAYREAQQLVQR VPKMKNKPRAPVVELSKVPLIQRGSANGL
>3UZT_2 C13.18 RNA Aptamer (chains B) CCAUACGGGAGAGAAACU
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 1 |
Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer. Tesmer, V.M., Lennarz, S., Mayer, G. et al. Structure (2012) 20:1300-1309. DOI 10.1016/j.str.2012.05.002 · PubMed
Other PDB entries of the same protein (UniProt P21146 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3UZT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.