3V2O: Ankyrin repeat family A protein 2

Crystal Structure of the Peptide Bound Complex of the Ankyrin Repeat Domains of Human ANKRA2. Determined by X-ray diffraction at 1.89 Å resolution. Released 4 Apr 2012.

Method: X-ray diffraction
Resolution: 1.89 Å
Organisms: Homo sapiens, Rattus norvegicus
Chains: 2
Atoms: 1,300
Mol. weight: 22.37 kDa
Released: 4 Apr 2012

Explore 3V2O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3V2O contains 11 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	153-159	7
α-helix	162-171	10
α-helix	185-191	7
α-helix	195-203	9
α-helix	218-225	8
α-helix	228-236	9
α-helix	251-257	7
α-helix	261-269	9
α-helix	284-291	8
α-helix	294-307	14

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	12-16	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ankyrin repeat family A protein 2	A	protein	183	Homo sapiens	Q9H9E1 (AlphaFold model)
Low-density lipoprotein receptor-related protein 2	B	protein	19	Rattus norvegicus	P98158

Sequence of entity 1 (A), FASTA

>3V2O_1 Ankyrin repeat family A protein 2 (chains A)
MHHHHHHSSRENLYFQGANSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAA
AHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGT
PLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLLQN
IKE

Sequence of entity 2 (B), FASTA

>3V2O_2 Low-density lipoprotein receptor-related protein 2 (chains B)
HYRKTGSLLPTLPKLPSLS

Primary citation

Sequence-Specific Recognition of a PxLPxI/L Motif by an Ankyrin Repeat Tumbler Lock. Xu, C., Jin, J., Bian, C. et al. Sci Signal (2012) 5:ra39-ra39. DOI 10.1126/scisignal.2002979 · PubMed

Other PDB entries of the same protein (UniProt Q9H9E1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3V31 1.57 Å, Crystal Structure of the Peptide Bound Complex of the Ankyrin Repeat Domains of Human…
4LG6 1.8 Å, Crystal structure of ANKRA2-CCDC8 complex
3V2X 1.85 Å, Crystal Structure of the Peptide Bound Complex of the Ankyrin Repeat Domains of Human…
3SO8 1.9 Å, Crystal Structure of ANKRA
4QQI 2.03 Å, Crystal structure of ANKRA2-RFX7 complex
8CXG 3.2 Å, Structures of Zika Virus in Complex with Antibodies Targeting E Dimer Epitopes and Basis…
8CXH 3.2 Å, Structures of Zika Virus in Complex with Antibodies Targeting E Dimer Epitopes and Basis…
8CXI 3.4 Å, Structures of Zika Virus in Complex with Antibodies Targeting E Dimer Epitopes and Basis…

Browse structure collections

About this viewer

MolViewer shows 3V2O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.