3V30: DNA-binding protein RFXANK

Crystal Structure of the Peptide Bound Complex of the Ankyrin Repeat Domains of Human RFXANK. Determined by X-ray diffraction at 1.57 Å resolution. Released 4 Apr 2012.

Method: X-ray diffraction
Resolution: 1.57 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,541
Mol. weight: 20.68 kDa
Released: 4 Apr 2012

Explore 3V30 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3V30 contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	94-99	6
α-helix	103-110	8
α-helix	115-118	4
α-helix	127-133	7
α-helix	137-146	10
α-helix	160-166	7
α-helix	170-177	8
α-helix	193-199	7
α-helix	203-211	9
α-helix	226-233	8
α-helix	236-249	14

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-11	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-binding protein RFXANK	A	protein	172	Homo sapiens	O14593 (AlphaFold model)
DNA-binding protein RFX5	B	protein	17	Homo sapiens	P48382 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3V30_1 DNA-binding protein RFXANK (chains A)
GDSLSIHQLAAQGELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETVRFLLEWGA
DPHILAKERESALSLASTGGYTDIVGLLLERDVDINIYDWNGGTPLLYAVRGNHVKCVEA
LLARGADLTTEADSGYTPMDLAVALGYRKVQQVIENHILKLFQSNLVPADPE

Sequence of entity 2 (B), FASTA

>3V30_2 DNA-binding protein RFX5 (chains B)
KTLVSMPPLPGLDLKGS

Primary citation

Sequence-Specific Recognition of a PxLPxI/L Motif by an Ankyrin Repeat Tumbler Lock. Xu, C., Jin, J., Bian, C. et al. Sci Signal (2012) 5:ra39-ra39. DOI 10.1126/scisignal.2002979 · PubMed

Other PDB entries of the same protein (UniProt O14593 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MEW 1.78 Å, RFXANK ankyrin repeats in complex with a RFX7 peptide
3UXG 1.85 Å, Crystal structure of RFXANK

Browse structure collections

About this viewer

MolViewer shows 3V30 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.