3V42: Renal tumor suppressor protein, folliculin

Crystal structure of renal tumor suppressor protein, folliculin. Determined by X-ray diffraction at 2.0 Å resolution. Released 15 Aug 2012.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,308
Mol. weight: 50.93 kDa
Released: 15 Aug 2012

Explore 3V42 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3V42 contains 24 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	349-356	8
α-helix	358-370	13
β-strand	373-377	5	1
α-helix	381-391	11
α-helix	392-394	3
α-helix	397-399	3
β-strand	402-406	5	1
β-strand	417-420	4	1
α-helix	424-427	4
α-helix	428-431	4
β-strand	436-443	8	1
β-strand	463-469	7	1
α-helix	481-491	11
α-helix	497-521	25
α-helix	530-538	9
α-helix	544-553	10
α-helix	554-556	3

Chain B: 12 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	349-356	8
α-helix	358-369	12
β-strand	373-377	5	1
α-helix	381-391	11
α-helix	392-394	3
α-helix	397-399	3
β-strand	402-406	5	1
β-strand	417-420	4	1
α-helix	428-431	4
β-strand	436-442	7	1
β-strand	464-469	6	1
α-helix	472	1
α-helix	481-491	11
α-helix	497-521	25
α-helix	529-538	10
α-helix	544-553	10
α-helix	554-556	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Folliculin	A, B	protein	226	Homo sapiens	Q8NFG4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3V42_1 Folliculin (chains A, B)
RKLPVFKSLRHMRQVLGAPSFRMLAWHVLMGNQVIWKSRDVDLVQSAFEVLRTMLPVGCV
RIIPYSSQYEEAYRCNFLGLSPHVQIPPHVLSSEFAVIVEVHAAARSTLHPVGAEDDQSL
SKYEFVVTSGSPVAADRVGPTILNKIEAALTNQNLSVDVVDQALVALKEEWMNKVKVLFK
FTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMTGLSKTYKSHLM

Primary citation

Crystal structure of folliculin reveals a hidDENN function in genetically inherited renal cancer. Nookala, R.K., Langemeyer, L., Pacitto, A. et al. Open Biol (2012) 2:120071-120071. DOI 10.1098/rsob.120071 · PubMed

Other PDB entries of the same protein (UniProt Q8NFG4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ULG 3.31 Å, Cryo-EM structure of the FLCN-FNIP2-Rag-Ragulator complex
8DHB 3.53 Å, Active FLCN GAP complex
6NZD 3.6 Å, Cryo-EM Structure of the Lysosomal Folliculin Complex (FLCN-FNIP2-RagA-RagC-Ragulator)

Browse structure collections

About this viewer

MolViewer shows 3V42 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.