Hsp90 alpha N-terminal domain in complex with a macrocyclic inhibitor. Determined by X-ray diffraction at 1.41 Å resolution. Released 18 Jul 2012.
Explore 3VHC in 3D Show helices and sheets RCSB PDB PDBe
3VHC contains 13 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-13 | 3 | |
| β-strand | 18-21 | 4 | 1 |
| α-helix | 22-23 | 2 | |
| α-helix | 24-35 | 12 | |
| α-helix | 43-65 | 23 | |
| α-helix | 67-72 | 6 | |
| β-strand | 78-83 | 6 | 1 |
| β-strand | 88-93 | 6 | 1 |
| α-helix | 100-104 | 5 | |
| α-helix | 105-109 | 5 | |
| α-helix | 111-112 | 2 | |
| α-helix | 115-123 | 9 | |
| α-helix | 128-134 | 7 | |
| α-helix | 137-143 | 7 | |
| β-strand | 145-153 | 9 | 1 |
| β-strand | 160-164 | 5 | 1 |
| β-strand | 169-174 | 6 | 1 |
| β-strand | 183-190 | 8 | 1 |
| α-helix | 192-198 | 7 | |
| α-helix | 200-210 | 11 | |
| β-strand | 218-220 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heat shock protein HSP 90-alpha | A | protein | 229 | Homo sapiens | P07900 (AlphaFold model) |
>3VHC_1 Heat shock protein HSP 90-alpha (chains A) MDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDP SKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGAD ISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVI LHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAE
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 1 |
| VHC | 4-amino-20,22-dimethyl-13-oxa-7-thia-3,5,17-triazatetracyclo[17.3.1.1~2,6~.1~8,… | C22 H22 N4 O2 S | 1 |
Design and synthesis of novel macrocyclic 2-amino-6-arylpyrimidine Hsp90 inhibitors. Suda, A., Koyano, H., Hayase, T. et al. Bioorg Med Chem Lett (2012) 22:1136-1141. DOI 10.1016/j.bmcl.2011.11.100 · PubMed
Other PDB entries of the same protein (UniProt P07900 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3VHC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.