Crystal structure of the human squalene synthase. Determined by X-ray diffraction at 1.52 Å resolution. Released 11 Apr 2012.
Explore 3VJ9 in 3D Show helices and sheets RCSB PDB PDBe
3VJ9 contains 24 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 38-51 | 14 | |
| α-helix | 52-54 | 3 | |
| α-helix | 55-59 | 5 | |
| α-helix | 64-84 | 21 | |
| α-helix | 90-103 | 14 | |
| α-helix | 120-123 | 4 | |
| α-helix | 125-133 | 9 | |
| α-helix | 137-157 | 21 | |
| α-helix | 165-172 | 8 | |
| α-helix | 173-177 | 5 | |
| α-helix | 178-190 | 13 | |
| α-helix | 195-199 | 5 | |
| α-helix | 201-218 | 18 | |
| α-helix | 220-225 | 6 | |
| α-helix | 233-236 | 4 | |
| α-helix | 243-247 | 5 | |
| α-helix | 249-251 | 3 | |
| α-helix | 252-267 | 16 | |
| α-helix | 270-278 | 9 | |
| α-helix | 283-303 | 21 | |
| α-helix | 308-311 | 4 | |
| α-helix | 318-327 | 10 | |
| α-helix | 331-346 | 16 | |
| α-helix | 356-368 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Squalene synthase | A | protein | 343 | Homo sapiens | P37268 (AlphaFold model) |
>3VJ9_1 Squalene synthase (chains A) GSHMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMT ISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADIC RRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSM GLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNAL HHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMD ATNMPAVKAIIYQYMEEIYHRIPDSDPSSSKTRQIISTIRTQN
Binding modes of zaragozic acid A to human squalene synthase and staphylococcal dehydrosqualene synthase. Liu, C.I., Jeng, W.Y., Chang, W.J. et al. J Biol Chem (2012) 287:18750-18757. DOI 10.1074/jbc.M112.351254 · PubMed
Other PDB entries of the same protein (UniProt P37268 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3VJ9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.