3VL1: Yeast Rpn14

Name: PDB 3VL1: Crystal structure of yeast Rpn14
Published: 2012-05-02
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Crystal structure of yeast Rpn14. Determined by X-ray diffraction at 1.6 Å resolution. Released 2 May 2012.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 7,164
Mol. weight: 93.32 kDa
Released: 2 May 2012

Explore 3VL1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3VL1 contains 13 α-helices and 80 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 40 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	1
α-helix	6-7	2
β-strand	8-10	3	2
α-helix	14-19	6
β-strand	27-35	9	2
β-strand	38-45	8	2
β-strand	54	1	2
β-strand	60-65	6	3
β-strand	68-73	6	3
β-strand	76-81	6	3
β-strand	85-86	2	4
α-helix	92	1
β-strand	96-102	7	5
β-strand	108-113	6	5
β-strand	118-121	4	5
β-strand	127-131	5	5
β-strand	139-144	6	6
β-strand	150-155	6	6
β-strand	159-164	6	6
β-strand	172-175	4	6
β-strand	181-187	7	7
β-strand	192-197	6	7
β-strand	202-206	5	7
β-strand	211-216	6	7
β-strand	218	1	8
β-strand	221	1	8
β-strand	226-233	8	9
α-helix	234-235	2
α-helix	240-242	3
α-helix	245-248	4
β-strand	257-263	7	9
β-strand	268-272	5	9
β-strand	278-282	5	9
β-strand	290-295	6	1
β-strand	302-307	6	1
β-strand	311-316	6	1
β-strand	325-329	5	1
β-strand	335-341	7	3
β-strand	344-349	6	3
β-strand	353-358	6	3
β-strand	359-360	2	10
β-strand	369-370	2	10
β-strand	376-378	3	3
α-helix	383-385	3
β-strand	387-391	5	4
β-strand	399-404	6	4
β-strand	408-413	6	4

Chain B: 6 helices, 40 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	11
α-helix	6	1
β-strand	7-10	4	12
α-helix	14-19	6
β-strand	27-35	9	12
β-strand	38-45	8	12
β-strand	54	1	12
β-strand	60-65	6	13
β-strand	68-73	6	13
β-strand	76-81	6	13
β-strand	85-86	2	14
α-helix	92-93	2
β-strand	96-102	7	15
β-strand	108-113	6	15
β-strand	118-121	4	15
β-strand	127-131	5	15
β-strand	139-144	6	16
β-strand	150-155	6	16
β-strand	160-164	5	16
β-strand	172-174	3	16
β-strand	181-187	7	17
β-strand	192-197	6	17
β-strand	202-206	5	17
β-strand	211-216	6	17
β-strand	218	1	18
β-strand	221	1	18
β-strand	226-233	8	19
α-helix	240-242	3
α-helix	245-248	4
β-strand	257-263	7	19
β-strand	268-272	5	19
β-strand	278-282	5	19
β-strand	290-295	6	11
β-strand	302-307	6	11
β-strand	311-316	6	11
β-strand	325-329	5	11
β-strand	335-341	7	13
β-strand	344-349	6	13
β-strand	353-358	6	13
β-strand	359-360	2	20
β-strand	369-370	2	20
β-strand	376-378	3	13
α-helix	383-385	3
β-strand	387-391	5	14
β-strand	399-404	6	14
β-strand	408-413	6	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
26S proteasome regulatory subunit RPN14	A, B	protein	420	Saccharomyces cerevisiae	P53196 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3VL1_1 26S proteasome regulatory subunit RPN14 (chains A, B)
GSHMTKTITVAHIQYDFKAVLEENDENDDEFYINVDKNLNEIKEHKIVVLGNSRGVDAGK
GNTFEKVGSHLYKARLDGHDFLFNTIIRDGSKMLKRADYTAVDTAKLQMRRFILGTTEGD
IKVLDSNFNLQREIDQAHVSEITKLKFFPSGEALISSSQDMQLKIWSVKDGSNPRTLIGH
RATVTDIAIIDRGRNVLSASLDGTIRLWECGTGTTIHTFNRKENPHDGVNSIALFVGTDR
QLHEISTSKKNNLEFGTYGKYVIAGHVSGVITVHNVFSKEQTIQLPSKFTCSCNSLTVDG
NNANYIYAGYENGMLAQWDLRSPECPVGEFLINEGTPINNVYFAAGALFVSSGFDTSIKL
DIISDPESERPAIEFETPTFLVSNDDAVSQFCYVSDDESNGEVLEVGKNNFCALYNLSNP

Primary citation

New crystal structure of the proteasome-dedicated chaperone Rpn14 at 1.6 A resolution. Kim, S., Nishide, A., Saeki, Y. et al. Acta Crystallogr Sect F Struct Biol Cryst Commun (2012) 68:517-521. DOI 10.1107/S1744309112011359 · PubMed

Other PDB entries of the same protein (UniProt P53196 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ACP 2.0 Å, Crystal Structure of Yeast Rpn14, a Chaperone of the 19S Regulatory Particle of the…
35ZV 3.11 Å, yeast 26S proteasome base assembly intermediate, Rpn14-Rpt6 (base-Rpn14-Hsm3-Nas6(2)…
36BL 3.91 Å, yeast 26S proteasome base assembly intermediate, base-Rpn14-Hsm3-Nas6(2) with Rpt4-EQ
36BD 3.93 Å, yeast 26S proteasome base assembly intermediate, base-Rpn14-Hsm3-Nas6 with Rpt4-EQ
36AX 4.87 Å, yeast 26S proteasome base assembly intermediate, base-Nas2-Rpn14-Hsm3-Nas6 with Rpt4-EQ

Browse structure collections

About this viewer

MolViewer shows 3VL1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.