3VU9: Psy3-Csm2 complex

Crystal Structure of Psy3-Csm2 complex. Determined by X-ray diffraction at 1.75 Å resolution. Released 10 Apr 2013.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 3,651
Mol. weight: 53.67 kDa
Released: 10 Apr 2013

Explore 3VU9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3VU9 contains 23 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	12-16	5
α-helix	27-29	3
α-helix	35-38	4
β-strand	43-47	5	1
α-helix	53-54	2
α-helix	55-61	7
β-strand	68-74	7	1
α-helix	82-84	3
β-strand	89-92	4	1
α-helix	100-112	13
α-helix	114-119	6
β-strand	129-136	8	1
α-helix	138-140	3
α-helix	152-171	20
β-strand	174-179	6	1
α-helix	182-185	4
β-strand	188	1	2
α-helix	213-216	4
β-strand	221-227	7	1
β-strand	232-236	5	1

Chain B: 11 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	3
α-helix	17-28	12
β-strand	34-41	8	3
α-helix	48-54	7
α-helix	60-62	3
α-helix	63-67	5
β-strand	69-73	5	3
α-helix	77-97	21
α-helix	108-109	2
β-strand	110-117	8	3
α-helix	119-129	11
α-helix	132-150	19
β-strand	157-165	9	3
α-helix	167-169	3
α-helix	171-176	6
β-strand	197	1	2
α-helix	199-206	8
β-strand	210-211	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Platinum sensitivity protein 3	A	protein	245	Saccharomyces cerevisiae	Q12318 (AlphaFold model)
Chromosome segregation in meiosis protein 2	B	protein	213	Saccharomyces cerevisiae	P40465 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3VU9_1 Platinum sensitivity protein 3 (chains A)
GSHMEVLKNIRIYPLSNFITSTKNYINLPNELRNLISEEQESKLGFLHIIESDFKPSVAL
QKLVNCTTGDEKILIIDIVSIWSQQKQRQHGAIYMNSLSCINITGLIVFLELLYDSPMDA
LRRCQVDNFNFQLRGIVIDNLSFLNFESDKNYDVINLSKFEKLFKILRKLREFLGCWIIT
KSFPTDFYNGIENTLVDKWSIKRKSGVTLYPTKLPDSYMKGMDLIIYREVVDGRPQYRRI
AALEE

Sequence of entity 2 (B), FASTA

>3VU9_2 Chromosome segregation in meiosis protein 2 (chains B)
MEYEDLELITIWPSPTKNKLCQFIKQNLSKEHVVTQLFFIDATSSFPLSQFQKLVPPTLP
ENVRIYENIRINTCLDLEELSAITVKLLQILSMNKINAQRGTEDAVTEPLKIILYINGLE
VMFRNSQFKSSPQRSHELLRDTLLKLRVMGNDENENASIRTLLEFPKEQLLDYYLKKNNN
TRTSSVRSKRRRIKNGDSLAEYIWKYYADSLFE

Primary citation

A new protein complex promoting the assembly of Rad51 filaments. Sasanuma, H., Tawaramoto, M.S., Lao, J.P. et al. Nat Commun (2013) 4:1676-1676. DOI 10.1038/ncomms2678 · PubMed

Other PDB entries of the same protein (UniProt Q12318 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4EQ6 1.8 Å, The crystal structure of Psy3-Csm2 complex from budding yeast
4DT1 1.9 Å, Crystal structure of the Psy3-Csm2 complex
9Q2H 2.74 Å, Rad55-Rad57-SHU homologous recombination complex
9Q2I 3.0 Å, Rad55-Rad57-SHU homologous recombination complex
9Q2C 3.06 Å, Rad55-Rad57-SHU-Rad51 bound to ssDNA with AMP-PNP
9Q2F 3.06 Å, Rad55-Rad57-SHU-Rad51-Rad51 bound to ssDNA with AMP-PNP
5XYN 3.3 Å, The crystal structure of Csm2-Psy3-Shu1-Shu2 complex from budding yeast
9Q2E 3.44 Å, Rad55-Rad57-SHU bound to ssDNA
9Q2L 3.7 Å, Rad55-Rad57(E161Q)-SHU-3xRad51 bound to ssDNA with ATP

Browse structure collections

About this viewer

MolViewer shows 3VU9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.