Crystal Structure Analysis of the mini-chaperonin variant with Pro 187 Gly. Determined by X-ray diffraction at 1.8 Å resolution. Released 13 Nov 2013.
Explore 3VZ7 in 3D Show helices and sheets RCSB PDB PDBe
3VZ7 contains 11 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 193-195 | 3 | 1 |
| β-strand | 199 | 1 | 2 |
| α-helix | 202-204 | 3 | |
| β-strand | 207 | 1 | 3 |
| α-helix | 208-210 | 3 | |
| β-strand | 212 | 1 | 3 |
| β-strand | 213-216 | 4 | 1 |
| β-strand | 219-222 | 4 | 2 |
| β-strand | 223 | 1 | 4 |
| β-strand | 226-227 | 2 | 5 |
| α-helix | 230-232 | 3 | |
| α-helix | 234-243 | 10 | |
| β-strand | 247-251 | 5 | 2 |
| β-strand | 253-254 | 2 | 5 |
| α-helix | 256-267 | 12 | |
| β-strand | 273-277 | 5 | 2 |
| α-helix | 278 | 1 | |
| α-helix | 282-296 | 15 | |
| β-strand | 301 | 1 | 4 |
| α-helix | 309-311 | 3 | |
| α-helix | 314-316 | 3 | |
| β-strand | 318-319 | 2 | 2 |
| β-strand | 320-325 | 6 | 1 |
| β-strand | 330-335 | 6 | 1 |
| α-helix | 339-355 | 17 | |
| α-helix | 359-374 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 60 kDa chaperonin | A | protein | 199 | Escherichia coli | P0A6F5 (AlphaFold model) |
>3VZ7_1 60 kDa chaperonin (chains A) HHHHHHGLVGRGSEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVL EAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIATLTG GTVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEAT SDYDREKLQERVAKLAGGV
Binding Energy(BE) from Crystal Packing of Mini-chaperones (mcpn) Provided Insights into the Allosteric Interaction of GroEL/ES Complex. Saijo, S., Sato, T. To be published.
Other PDB entries of the same protein (UniProt P0A6F5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3VZ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.