Crystal Structure Analysis of the Mini-chaperonin variant with Leu 185, Val 186, Pro 187, Arg 188 and Ser 190 replaced with all Gly. Determined by X-ray diffraction at 1.9 Å resolution. Released 13 Nov 2013.
Explore 3VZ8 in 3D Show helices and sheets RCSB PDB PDBe
3VZ8 contains 30 α-helices and 37 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 193-195 | 3 | 1 |
| β-strand | 199 | 1 | 2 |
| α-helix | 202-204 | 3 | |
| β-strand | 207 | 1 | 1 |
| α-helix | 208-210 | 3 | |
| β-strand | 212-216 | 5 | 1 |
| β-strand | 219-227 | 9 | 2 |
| α-helix | 230-233 | 4 | |
| α-helix | 234-243 | 10 | |
| β-strand | 247-254 | 8 | 2 |
| α-helix | 256-267 | 12 | |
| β-strand | 273-277 | 5 | 2 |
| α-helix | 278 | 1 | |
| α-helix | 282-296 | 15 | |
| β-strand | 300-301 | 2 | 2 |
| β-strand | 303 | 1 | 3 |
| β-strand | 307 | 1 | 3 |
| α-helix | 309-311 | 3 | |
| α-helix | 314-316 | 3 | |
| β-strand | 318-319 | 2 | 2 |
| β-strand | 320-326 | 7 | 1 |
| β-strand | 330-335 | 6 | 1 |
| α-helix | 339-355 | 17 | |
| α-helix | 359-375 | 17 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 193-195 | 3 | 4 |
| β-strand | 199 | 1 | 5 |
| α-helix | 202-204 | 3 | |
| β-strand | 207 | 1 | 6 |
| α-helix | 208-210 | 3 | |
| β-strand | 212 | 1 | 6 |
| β-strand | 213-216 | 4 | 4 |
| β-strand | 219-227 | 9 | 5 |
| α-helix | 230-243 | 14 | |
| β-strand | 247-254 | 8 | 5 |
| α-helix | 256-267 | 12 | |
| β-strand | 273-277 | 5 | 5 |
| α-helix | 278 | 1 | |
| α-helix | 282-296 | 15 | |
| β-strand | 300-301 | 2 | 5 |
| α-helix | 314-316 | 3 | |
| β-strand | 318-319 | 2 | 5 |
| β-strand | 320-325 | 6 | 4 |
| β-strand | 330-335 | 6 | 4 |
| α-helix | 339-355 | 17 | |
| α-helix | 359-374 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 193-195 | 3 | 7 |
| β-strand | 199 | 1 | 8 |
| α-helix | 202-204 | 3 | |
| β-strand | 207 | 1 | 9 |
| α-helix | 208-210 | 3 | |
| β-strand | 212 | 1 | 9 |
| β-strand | 213-216 | 4 | 7 |
| β-strand | 219-227 | 9 | 8 |
| α-helix | 230-243 | 14 | |
| β-strand | 247-254 | 8 | 8 |
| α-helix | 256-267 | 12 | |
| β-strand | 273-277 | 5 | 8 |
| α-helix | 278 | 1 | |
| α-helix | 282-296 | 15 | |
| β-strand | 300-301 | 2 | 8 |
| α-helix | 309-311 | 3 | |
| α-helix | 314-316 | 3 | |
| β-strand | 318-319 | 2 | 8 |
| β-strand | 320-325 | 6 | 7 |
| β-strand | 330-335 | 6 | 7 |
| α-helix | 339-354 | 16 | |
| α-helix | 359-373 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 60 kDa chaperonin | A, B, C | protein | 199 | Escherichia coli | P0A6F5 (AlphaFold model) |
>3VZ8_1 60 kDa chaperonin (chains A, B, C) HHHHHHGGGGGGGEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVL EAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIATLTG GTVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEAT SDYDREKLQERVAKLAGGV
Binding Energy(BE) from Crystal Packing of Mini-chaperones (mcpn) Provided Insights into the Allosteric Interaction of GroEL/ES Complex. Saijo, S., Sato, T. To be published.
Other PDB entries of the same protein (UniProt P0A6F5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3VZ8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.