3W6R: GAP domain of human MgcRacGAP

Crystal structure of the GAP domain of human MgcRacGAP. Determined by X-ray diffraction at 1.9 Å resolution. Released 26 Feb 2014.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,717
Mol. weight: 22.79 kDa
Released: 26 Feb 2014

Explore 3W6R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3W6R contains 12 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	351-354	4
α-helix	364-376	13
α-helix	390-403	14
α-helix	409-411	3
α-helix	415-427	13
α-helix	439-447	9
α-helix	451-463	13
α-helix	467-484	18
α-helix	493-500	8
α-helix	501-505	5
α-helix	514-533	20
α-helix	536-540	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rac GTPase-activating protein 1	A	protein	202	Homo sapiens	Q9H0H5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3W6R_1 Rac GTPase-activating protein 1 (chains A)
GAMEGMLADFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVK
TVPLLSKVDDIHAICSLLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGE
LPQANRDTLAFLMIHLQRVAQSPHTKMDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQ
PKVVERLLSLPLEYWSQFMMVE

Primary citation

Crystal structure of GTPase-activating domain from human MgcRacGAP. Matsuura, A., Lee, H.H. Biochem Biophys Res Commun (2013) 435:367-372. DOI 10.1016/j.bbrc.2013.04.094 · PubMed

Other PDB entries of the same protein (UniProt Q9H0H5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5C2K 1.42 Å, Crystal structure of the fusion protein linked by RhoA and the GAP domain of MgcRacGAP
2OVJ 1.49 Å, The crystal structure of the human Rac GTPase activating protein 1 (RACGAP1) MgcRacGAP.
3WPQ 1.84 Å, crystal structure of the GAP domain of MgcRacGAP(S387A)
4B6D 2.2 Å, Structure of the atypical C1 domain of MgcRacGAP
5C2J 2.5 Å, Complex structure of the GAP domain of MgcRacGAP and Cdc42
3WPS 2.7 Å, crystal structure of the GAP domain of MgcRacGAP(S387D)

Browse structure collections

About this viewer

MolViewer shows 3W6R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.