3W8I: CCM3

Crystal structure of CCM3 in complex with the C-terminal regulatory domain of MST4. Determined by X-ray diffraction at 2.4 Å resolution. Released 3 Jul 2013.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,119
Mol. weight: 33.1 kDa
Released: 3 Jul 2013

Explore 3W8I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3W8I contains 18 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	20-21	2
α-helix	22-26	5
α-helix	27-33	7
α-helix	38-54	17
α-helix	58-69	12
α-helix	76-82	7
α-helix	89-91	3
α-helix	98-115	18
α-helix	117-120	4
α-helix	124-149	26
α-helix	161-184	24
α-helix	187-207	21

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	-2-350	7
α-helix	352	1
α-helix	353-357	5
α-helix	358-366	9
α-helix	372-391	20
α-helix	395-407	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Programmed cell death protein 10	A	protein	213	Homo sapiens	Q9BUL8 (AlphaFold model)
Serine/threonine-protein kinase MST4	B	protein	76	Homo sapiens	Q9P289 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3W8I_1 Programmed cell death protein 10 (chains A)
MKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKIL
EKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRF
LQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKA
INVFVSANRLIHQTNLILQTFKTVALEHHHHHH

Sequence of entity 2 (B), FASTA

>3W8I_2 Serine/threonine-protein kinase MST4 (chains B)
GPGSMLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMV
KKLIEKFQKCSADESP

Primary citation

Structural Basis for the Unique Heterodimeric Assembly between Cerebral Cavernous Malformation 3 and Germinal Center Kinase III. Xu, X., Wang, X., Zhang, Y. et al. Structure (2013) 21:1059-1066. DOI 10.1016/j.str.2013.04.007 · PubMed

Other PDB entries of the same protein (UniProt Q9BUL8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4GEH 1.95 Å, Crystal structure of MST4 dimerization domain complex with PDCD10
3AJM 2.3 Å, Crystal structure of programmed cell death 10 in complex with inositol…
3W8H 2.43 Å, Crystal structure of CCM3 in complex with the C-terminal regulatory domain of STK25
3L8I 2.5 Å, Crystal structure of CCM3, a cerebral cavernous malformation protein critical for…
3RQG 2.5 Å, Cerebral cavernous malformation 3 (CCM3) in complex with paxillin LD4
3RQF 2.7 Å, Cerebral cavernous malformation 3 (CCM3) in complex with paxillin LD2
3RQE 2.8 Å, Cerebral cavernous malformation 3 (CCM3) in complex with paxillin LD1
4TVQ 2.8 Å, CCM3 in complex with CCM2 LD-like motif
3L8J 3.05 Å, Crystal structure of CCM3, a cerebral cavernous malformation protein critical for…

Browse structure collections

About this viewer

MolViewer shows 3W8I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.