3WPQ: GAP domain of MgcRacGAP(S387A)

crystal structure of the GAP domain of MgcRacGAP(S387A). Determined by X-ray diffraction at 1.84 Å resolution. Released 21 Jan 2015.

Method: X-ray diffraction
Resolution: 1.84 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,723
Mol. weight: 46.35 kDa
Released: 21 Jan 2015

Explore 3WPQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WPQ contains 27 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	351-354	4
α-helix	364-376	13
α-helix	387-389	3
α-helix	390-397	8
α-helix	398-402	5
α-helix	409-411	3
α-helix	415-427	13
α-helix	439-447	9
α-helix	451-462	12
α-helix	467-485	19
α-helix	493-500	8
α-helix	501-505	5
α-helix	514-532	19
α-helix	536-540	5

Chain B: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	351-354	4
α-helix	364-376	13
α-helix	387-389	3
α-helix	390-403	14
α-helix	409-411	3
α-helix	415-427	13
α-helix	439-447	9
α-helix	451-463	13
α-helix	467-485	19
α-helix	493-500	8
α-helix	501-505	5
α-helix	514-533	20
α-helix	536-540	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rac GTPase-activating protein 1	A, B	protein	208	Homo sapiens	Q9H0H5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3WPQ_1 Rac GTPase-activating protein 1 (chains A, B)
GSSGSSGIGEGMLADFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRIAGCDRTVKELKE
KFLRVKTVPLLSKVDDIHAICSLLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAM
YQAVGELPQANRDTLAFLMIHLQRVAQSPHTKMDVANLAKVFGPTIVAHAVPNPDPVTMS
QDIKRQPKVVERLLSLPLEYWSQFMMVE

Primary citation

Structural basis for the effects of Ser387 phosphorylation of MgcRacGAP on its GTPase-activating activities for CDC42 and RHOA. Murayama, K., Kato-Murayama, M., Hosaka, T. et al. J Struct Biol (2024) 216:108151-108151. DOI 10.1016/j.jsb.2024.108151 · PubMed

Other PDB entries of the same protein (UniProt Q9H0H5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5C2K 1.42 Å, Crystal structure of the fusion protein linked by RhoA and the GAP domain of MgcRacGAP
2OVJ 1.49 Å, The crystal structure of the human Rac GTPase activating protein 1 (RACGAP1) MgcRacGAP.
3W6R 1.9 Å, Crystal structure of the GAP domain of human MgcRacGAP
4B6D 2.2 Å, Structure of the atypical C1 domain of MgcRacGAP
5C2J 2.5 Å, Complex structure of the GAP domain of MgcRacGAP and Cdc42
3WPS 2.7 Å, crystal structure of the GAP domain of MgcRacGAP(S387D)

Browse structure collections

About this viewer

MolViewer shows 3WPQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.