3WSO: Skp1-FBG3 complex

Crystal structure of the Skp1-FBG3 complex. Determined by X-ray diffraction at 2.6 Å resolution. Released 25 Mar 2015.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,221
Mol. weight: 48.85 kDa
Released: 25 Mar 2015

Explore 3WSO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WSO contains 20 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
α-helix	11-19	9
α-helix	23-28	6
α-helix	30-32	3
α-helix	35-41	7
α-helix	44-53	10
α-helix	68-77	10
β-strand	95-99	5	1
β-strand	105-108	4	2
α-helix	111-114	4
β-strand	124-127	4	2
β-strand	133-140	8	1
α-helix	142-144	3
α-helix	148-154	7
β-strand	157-165	9	2
β-strand	172-181	10	1
β-strand	187-191	5	1
α-helix	195-201	7
β-strand	207-213	7	2
β-strand	222-231	10	1
β-strand	242-251	10	2

Chain B: 9 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	3
β-strand	13-17	5	3
α-helix	20-22	3
α-helix	25-30	6
β-strand	45-46	2	3
α-helix	52-64	13
α-helix	87-92	6
α-helix	97-110	14
α-helix	113-125	13
α-helix	132-139	8
α-helix	147-156	10
α-helix	158-160	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F-box only protein 44	A	protein	255	Homo sapiens	Q9H4M3 (AlphaFold model)
S-phase kinase-associated protein 1	B	protein	166	Homo sapiens	P63208 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3WSO_1 F-box only protein 44 (chains A)
MAVGNINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLVTLWKRKCLREGFITED
WDQPVADWKIFYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPND
QVKKYFVTSYYTCLKSQVVDLKAEGYWEELMDTTRPDIEVKDWFAARPDCGSKYQLCVQL
LSSAHAPLGTFQPDPATIQQKSDAKWREVSHTFSNYPPGVRYIWFQHGGVDTHYWAGWYG
PRVTNSSITIRPPLP

Sequence of entity 2 (B), FASTA

>3WSO_2 S-phase kinase-associated protein 1 (chains B)
GPHMPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKK
VIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLD
VTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK

Primary citation

The Structural Differences between a Glycoprotein Specific F-Box Protein Fbs1 and Its Homologous Protein FBG3. Kumanomidou, T., Nishio, K., Takagi, K. et al. PLoS One (2015) 10:e0140366-e0140366. DOI 10.1371/journal.pone.0140366 · PubMed

Other PDB entries of the same protein (UniProt Q9H4M3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5B4N 2.3 Å, Structure analysis of function associated loop mutant of substrate recognition domain of…

Browse structure collections

About this viewer

MolViewer shows 3WSO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.