3WTD: PAXX

Structure of PAXX. Determined by X-ray diffraction at 2.35 Å resolution. Released 21 Jan 2015.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,067
Mol. weight: 35.71 kDa
Released: 21 Jan 2015

Explore 3WTD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WTD contains 11 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	1
α-helix	17-18	2
β-strand	20-25	6	1
β-strand	38-42	5	1
β-strand	47-49	3	1
α-helix	54-64	11
α-helix	73-82	10
β-strand	85-90	6	1
β-strand	93-98	6	1
β-strand	105-111	7	1
α-helix	112-113	2
α-helix	114-140	27

Chain B: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	2
α-helix	17-18	2
β-strand	20-25	6	2
α-helix	35-37	3
β-strand	38-42	5	2
β-strand	47-49	3	2
α-helix	54-63	10
α-helix	73-82	10
β-strand	85-89	5	2
β-strand	93-98	6	2
β-strand	105-111	7	2
α-helix	112-113	2
α-helix	114-143	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Uncharacterized protein C9orf142	A, B	protein	168	Homo sapiens	Q9BUH6 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3WTD_1 Uncharacterized protein C9orf142 (chains A, B)
GSMDPLSPPLCTLPPGPEPPRFVCYCEGEESGEGDRGGFNLYVTDAAELWSTCFTPDSLA
ALKARFGLSAAEDITPRFRAACEQQAVALTLQEDRASLTLSGGPSALAFDLSKVPGPEAA
PRLRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGPQLFLPDPD

Primary citation

DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. Ochi, T., Blackford, A.N., Coates, J. et al. Science (2015) 347:185-188. DOI 10.1126/science.1261971 · PubMed

Other PDB entries of the same protein (UniProt Q9BUH6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4WJA 2.6 Å, Crystal Structure of PAXX
7ZYG 2.68 Å, CryoEM structure of Ku heterodimer bound to DNA, PAXX and XLF
7ZWA 2.8 Å, CryoEM structure of Ku heterodimer bound to DNA and PAXX
9CQ3 2.8 Å, The gap-filling complex with Pol mu engaged in the NHEJ pathway
9GYF 2.8 Å, Ku70/80 with PAXX peptide mutation K193R
9N81 2.8 Å, A gap-filling complex with Pol mu engaged in the NHEJ Pathway
8ASC 2.95 Å, Ku70/80 binds to the Ku-binding motif of PAXX
9CQ6 3.1 Å, The ligation complex in the NHEJ pathway
9N83 3.1 Å, The ligation complex in the NHEJ pathway
9N82 3.3 Å, The ligation (AMP-Lys) complex in the NHEJ pathway
9CQC 3.4 Å, The ligation complex like in the NHEJ pathway
3WTF 3.45 Å, Structure of PAXX

Browse structure collections

About this viewer

MolViewer shows 3WTD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.