4WJA: PAXX

Crystal Structure of PAXX. Determined by X-ray diffraction at 2.6 Å resolution. Released 11 Mar 2015.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,939
Mol. weight: 34.61 kDa
Released: 11 Mar 2015

Explore 4WJA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WJA contains 11 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	1
α-helix	16-18	3
β-strand	20-25	6	1
β-strand	38-42	5	1
β-strand	47-49	3	1
α-helix	54-63	10
α-helix	73-81	9
β-strand	85-90	6	1
β-strand	93-98	6	1
β-strand	105-111	7	1
α-helix	112-113	2
α-helix	114-140	27

Chain B: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	2
α-helix	17-18	2
β-strand	20-25	6	2
α-helix	34-37	4
β-strand	38-42	5	2
β-strand	47-49	3	2
α-helix	54-63	10
α-helix	73-81	9
β-strand	85-88	4	3
β-strand	95-98	4	3
β-strand	105-108	4	3
β-strand	110-111	2	2
α-helix	112-113	2
α-helix	114-137	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Uncharacterized protein C9orf142	A, B	protein	161	Homo sapiens	Q9BUH6 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4WJA_1 Uncharacterized protein C9orf142 (chains A, B)
MGSSHHHHHHSQGSEFMDPLSPPLCTLPPGPEPPRFVCYCEGEESGEGDRGGFNLYVTDA
AELWSTCFTPDSLAALKARFGLSAAEDITPRFRAACEQQAVALTLQEDRASLTLSGGPSA
LAFDLSKVPGPEAAPRLRALTLGLAKRVWSLERRLAAAEET

Primary citation

Interactome analysis identifies a new paralogue of XRCC4 in non-homologous end joining DNA repair pathway. Xing, M., Yang, M., Huo, W. et al. Nat Commun (2015) 6:6233-6233. DOI 10.1038/ncomms7233 · PubMed

Other PDB entries of the same protein (UniProt Q9BUH6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3WTD 2.35 Å, Structure of PAXX
7ZYG 2.68 Å, CryoEM structure of Ku heterodimer bound to DNA, PAXX and XLF
7ZWA 2.8 Å, CryoEM structure of Ku heterodimer bound to DNA and PAXX
9CQ3 2.8 Å, The gap-filling complex with Pol mu engaged in the NHEJ pathway
9GYF 2.8 Å, Ku70/80 with PAXX peptide mutation K193R
9N81 2.8 Å, A gap-filling complex with Pol mu engaged in the NHEJ Pathway
8ASC 2.95 Å, Ku70/80 binds to the Ku-binding motif of PAXX
9CQ6 3.1 Å, The ligation complex in the NHEJ pathway
9N83 3.1 Å, The ligation complex in the NHEJ pathway
9N82 3.3 Å, The ligation (AMP-Lys) complex in the NHEJ pathway
9CQC 3.4 Å, The ligation complex like in the NHEJ pathway
3WTF 3.45 Å, Structure of PAXX

Browse structure collections

About this viewer

MolViewer shows 4WJA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.