3ZHK: Single domain antibody 2x1 scaffold

The crystal structure of single domain antibody 2x1 scaffold. Determined by X-ray diffraction at 1.96 Å resolution. Released 8 Jan 2014.

Method: X-ray diffraction
Resolution: 1.96 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,794
Mol. weight: 27.7 kDa
Released: 8 Jan 2014

Explore 3ZHK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ZHK contains 5 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-12	3	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	45-51	7	2
β-strand	57-60	4	2
β-strand	68-73	6	1
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-99	8	2
β-strand	106-109	4	2
β-strand	113-117	5	2

Chain B: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	3
β-strand	10-12	3	2
β-strand	18-25	8	3
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	45-51	7	2
β-strand	57-60	4	2
α-helix	62-64	3
β-strand	68-73	6	3
β-strand	78-83	6	3
α-helix	88-90	3
β-strand	92-99	8	2
β-strand	106-109	4	2
β-strand	113-117	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MG2X1 scaffold antibody	A, B	protein	127	HOMO SAPIENS	P01764 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3ZHK_1 MG2X1 SCAFFOLD ANTIBODY (chains A, B)
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYY
ADSVKGRFTISRDNSKNLLYLQMNSLRAEDTAVYYCARHAPSTEAPDYWGQGTLVTVSSL
EHHHHHH

Primary citation

Directed Evolution of Human Heavy Chain Variable Domain (Vh) Using in Vivo Protein Fitness Filter. Kim, D., Song, H., Nam, H.J. et al. PLoS One (2014) 9:98178. DOI 10.1371/JOURNAL.PONE.0098178 · PubMed

Other PDB entries of the same protein (UniProt P01764 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZHD 1.96 Å, The crystal structure of single domain antibody 8-4 scaffold.
1OHQ 2.0 Å, Crystal structure of HEL4, a soluble human VH antibody domain resistant to aggregation
3ZHL 2.47 Å, The crystal structure of single domain antibody 8-14 scaffold
3UPC 2.8 Å, A general strategy for the generation of human antibody variable domains with increased…
4KFZ 2.8 Å, Crystal structure of LMO2 and anti-LMO2 VH complex
9N7Q 3.18 Å, H1 hemagglutinin (A/Michigan/45/2015) in complex with anchor-targeting Fab ST15

Browse structure collections

About this viewer

MolViewer shows 3ZHK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.