3ZNZ: OTULIN OTU domain

Crystal structure of OTULIN OTU domain (C129A) in complex with Met1- di ubiquitin. Determined by X-ray diffraction at 1.9 Å resolution. Released 26 Jun 2013.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 3,754
Mol. weight: 49.7 kDa
Released: 26 Jun 2013

Explore 3ZNZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ZNZ contains 28 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	82	1	1
α-helix	83-85	3
β-strand	86-87	2	2
α-helix	88-95	8
α-helix	101-113	13
β-strand	119-121	3	2
α-helix	122	1
β-strand	123	1	1
α-helix	124	1
β-strand	126	1	3
α-helix	129-140	12
α-helix	147-150	4
α-helix	152-156	5
α-helix	157-164	8
α-helix	166-170	5
α-helix	171-173	3
α-helix	184-203	20
α-helix	208-218	11
α-helix	222-248	27
α-helix	255-260	6
α-helix	269-272	4
α-helix	273-277	5
β-strand	280	1	4
β-strand	284	1	4
β-strand	286-287	2	5
α-helix	288-298	11
β-strand	301-306	6	6
α-helix	307-309	3
β-strand	316-319	4	6
β-strand	329-334	6	6
β-strand	341	1	6
β-strand	342-344	3	2
α-helix	346-348	3

Chain B: 8 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	7
β-strand	12-16	5	7
β-strand	22	1	8
α-helix	23-34	12
α-helix	38-40	3
β-strand	43-45	3	7
β-strand	48-49	2	7
α-helix	50-51	2
β-strand	55	1	8
α-helix	57-59	3
β-strand	66-69	4	7
β-strand	74-75	2	5
β-strand	77	1	3
β-strand	78-82	5	9
β-strand	88-92	5	9
β-strand	98	1	10
α-helix	99-110	12
α-helix	114-116	3
β-strand	119-121	3	9
β-strand	124-125	2	9
α-helix	126-127	2
β-strand	131	1	10
α-helix	133-135	3
β-strand	142-145	4	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein FAM105B	A	protein	275	HOMO SAPIENS	Q96BN8 (AlphaFold model)
Polyubiquitin-C	B	protein	152	HOMO SAPIENS	P0CG48 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3ZNZ_1 PROTEIN FAM105B (chains A)
GPLSVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKFTSIRRVRGDNYAALRATLFQ
AMSQAVGLPPWLQDPELMLLPEKLISKYNWIKQWKLGLKFDGKNEDLVDKIKESLTLLRK
KWAGLAEMRTAEARQIACDELFTNEAEEYSLYEAVKFLMLNRAIELYNDKEKGKEVPFFS
VLLFARDTSNDPGQLLRNHLNQVGHTGGLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFIT
VYPTDPPKDWPVVTLIAEDDRHYNIPVRVCEETSL

Sequence of entity 2 (B), FASTA

>3ZNZ_2 POLYUBIQUITIN-C (chains B)
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG

Primary citation

Otulin Antagonizes Lubac Signaling by Specifically Hydrolyzing met1-Linked Polyubiquitin. Keusekotten, K., Elliott, P.R., Glockner, L. et al. Cell (2013) 153:1312. DOI 10.1016/J.CELL.2013.05.014 · PubMed

Other PDB entries of the same protein (UniProt Q96BN8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZNV 1.3 Å, Crystal structure of the OTU domain of OTULIN at 1.3 Angstroms.
3ZNX 1.35 Å, Crystal structure of the OTU domain of OTULIN D336A mutant
4KSJ 1.6 Å, Crystal structure of the OTU domain of Gumby/Fam105B at 1.6 angstrom
6I9C 1.77 Å, Structure of the OTU domain of OTULIN G281R mutant
6SAK 2.0 Å, Structure of the OTULINcat C129A - SNX27 PDZ domain complex.
9LZX 2.0 Å, Crystal structure of the OTU domain of OTULIN in complex with 11B6
4OYK 2.0 Å, Structure of HOIP PUB domain bound to OTULIN PIM
4KSK 2.4 Å, Gumby/Fam105B in complex with ubiquitin
4P0B 2.7 Å, Crystal structure of HOIP PUB domain in complex with OTULIN PIM
4KSL 2.83 Å, Gumby/Fam105B in complex with linear di-ubiquitin
5OE7 2.95 Å, Structure of OTULIN bound to the Met1-linked diubiquitin activity probe

Browse structure collections

About this viewer

MolViewer shows 3ZNZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.