3ZRT: Human PSD-95 PDZ1-2

Crystal structure of human PSD-95 PDZ1-2. Determined by X-ray diffraction at 3.4 Å resolution. Released 21 Mar 2012.

Method: X-ray diffraction
Resolution: 3.4 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 5,311
Mol. weight: 85.39 kDa
Released: 21 Mar 2012

Explore 3ZRT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ZRT contains 19 α-helices and 74 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 6 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	-2--1	2
β-strand	3-11	9	1
β-strand	13-14	2	2
β-strand	16	1	2
β-strand	19-23	5	1
β-strand	30	1	3
β-strand	33	1	3
β-strand	36-41	6	1
α-helix	46-50	5
α-helix	57	1
β-strand	58-62	5	1
β-strand	65-66	2	1
α-helix	72-80	9
β-strand	85-93	9	1
β-strand	99-106	8	4
β-strand	108	1	5
β-strand	111	1	5
β-strand	114-118	5	4
β-strand	125	1	6
β-strand	128	1	6
β-strand	131-136	6	4
α-helix	141-145	5
β-strand	153-157	5	4
β-strand	160-161	2	4
α-helix	167-175	9
β-strand	180-187	8	4

Chain C: 4 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	3-11	9	13
β-strand	13-14	2	14
β-strand	16	1	14
β-strand	19-23	5	13
β-strand	30	1	15
β-strand	33	1	15
β-strand	36-41	6	13
α-helix	46-50	5
β-strand	58-62	5	13
β-strand	65-66	2	13
α-helix	72-80	9
β-strand	85-93	9	13
β-strand	99-106	8	16
β-strand	108	1	17
β-strand	111	1	17
β-strand	114-118	5	16
β-strand	125	1	18
β-strand	128	1	18
β-strand	131-136	6	16
α-helix	141-145	5
β-strand	153-157	5	16
β-strand	160-161	2	16
α-helix	167-175	9
β-strand	180-187	8	16

Chain D: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	19
β-strand	58-62	5	19
β-strand	65-66	2	19
β-strand	88-93	6	19
β-strand	99-106	8	20
β-strand	108	1	21
β-strand	111	1	21
β-strand	114-118	5	20
β-strand	125	1	22
β-strand	128	1	22
β-strand	131-136	6	20
α-helix	141-145	5
α-helix	152	1
β-strand	153-157	5	20
β-strand	160-161	2	20
α-helix	167-175	9
β-strand	180-187	8	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 4	A, B, C, D	protein	199	HOMO SAPIENS	P78352 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3ZRT_1 DISKS LARGE HOMOLOG 4 (chains A, B, C, D)
MHHHHHPRGSMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGR
LRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGL
GFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVA
ALKNTYDVVYLKVAKPSNA

Primary citation

A High-Affinity, Dimeric Inhibitor of Psd-95 Bivalently Interacts with Pdz1-2 and Protects Against Ischemic Brain Damage. Bach, A., Clausen, B.H., Moller, M. et al. Proc Natl Acad Sci U S A (2012) 109:3317. DOI 10.1073/PNAS.1113761109 · PubMed

Other PDB entries of the same protein (UniProt P78352 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9TNG 0.95 Å, Crystal Structure of the third PDZ domain of PSD-95 protein E401R mutant
6QJL 1.04 Å, Crystal Structure of the third PDZ domain of PSD-95 protein D332G mutant: space group P21
6QJK 1.05 Å, Crystal Structure of the third PDZ domain of PSD-95 protein D332G mutant: space group P43
8AH5 1.25 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P212121…
8AH7 1.25 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P212121…
3I4W 1.35 Å, Crystal Structure of the third PDZ domain of PSD-95
3K82 1.4 Å, Crystal Structure of the third PDZ domain of PSD-95
9TNF 1.45 Å, Crystal Structure of the third PDZ domain of PSD-95 protein Y397E mutant
8AH4 1.48 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P3112 at…
6QJF 1.5 Å, Crystal Structure of the third PDZ domain of PSD-95 protein D332P mutant: space group…
6QJI 1.5 Å, Crystal Structure of the third PDZ domain of PSD-95 protein: space group P3112
8AH8 1.5 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P3121 at…

Browse structure collections

About this viewer

MolViewer shows 3ZRT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.