Crystal structure of the tandem VHS and FYVE domains of Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS-Hrs) at 1.48 A resolution. Determined by X-ray diffraction at 1.48 Å resolution. Released 7 Sept 2011.
Explore 3ZYQ in 3D Show helices and sheets RCSB PDB PDBe
3ZYQ contains 16 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-15 | 9 | |
| α-helix | 25-36 | 12 | |
| α-helix | 42-53 | 12 | |
| α-helix | 58-75 | 18 | |
| α-helix | 77-83 | 7 | |
| α-helix | 86-98 | 13 | |
| α-helix | 102-118 | 17 | |
| α-helix | 123-125 | 3 | |
| α-helix | 126-138 | 13 | |
| α-helix | 142-145 | 4 | |
| α-helix | 147-150 | 4 | |
| α-helix | 152-162 | 11 | |
| β-strand | 165 | 1 | 1 |
| α-helix | 171 | 1 | |
| β-strand | 172 | 1 | 1 |
| α-helix | 173 | 1 | |
| β-strand | 174 | 1 | 2 |
| β-strand | 177 | 1 | 2 |
| β-strand | 180-181 | 2 | 3 |
| β-strand | 188-189 | 2 | 3 |
| β-strand | 196-200 | 5 | 4 |
| α-helix | 201-203 | 3 | |
| β-strand | 205-211 | 7 | 4 |
| α-helix | 213-219 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hepatocyte growth factor-regulated tyrosine kinase substrate | A | protein | 226 | HOMO SAPIENS | O14964 (AlphaFold model) |
>3ZYQ_1 HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE SUBSTRATE (chains A) SMGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPH VALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAF RNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRK HHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Water and common crystallization additives (SO4, EDO) are not listed.
Crystal Structure of the Tandem Vhs and Fyve Domains of Hepatocyte Growth Factor-Regulated Tyrosine Kinase Substrate (Hgs-Hrs) at 1.48 A Resolution. Muniz, J.R.C., Ayinampudi, V., Shrestha, L. et al. To be published.
Other PDB entries of the same protein (UniProt O14964 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3ZYQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.