4A14: Kinesin-like protein KIF7

Human KIF7, a kinesin involved in hedgehog signalling. Determined by X-ray diffraction at 1.6 Å resolution. Released 25 Jan 2012.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 2,709
Mol. weight: 37.9 kDa
Ligands: MG, ADP
Released: 25 Jan 2012

Explore 4A14 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4A14 contains 18 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	12-13	2
β-strand	14-19	6	1
α-helix	20-23	4
α-helix	24-28	5
β-strand	33	1	2
β-strand	35-38	4	3
α-helix	39-41	3
β-strand	43-46	4	3
β-strand	50-53	4	3
β-strand	56-58	3	1
α-helix	64-67	4
α-helix	68-72	5
α-helix	73-80	8
β-strand	85-90	6	1
α-helix	97-101	5
α-helix	116-130	15
β-strand	135-146	12	1
β-strand	149-152	4	1
α-helix	160-162	3
β-strand	164-167	4	4
β-strand	173-176	4	4
β-strand	181-182	2	1
α-helix	186-201	16
α-helix	211-213	3
β-strand	215-225	11	1
β-strand	240-249	10	1
α-helix	250-252	3
α-helix	275-286	12
α-helix	298-300	3
α-helix	302-306	5
β-strand	316-323	8	1
β-strand	326	1	2
α-helix	327-329	3
α-helix	330-342	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinesin-like protein KIF7	A	protein	344	HOMO SAPIENS	Q2M1P5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4A14_1 KINESIN-LIKE PROTEIN KIF7 (chains A)
GAMGLPGAEEAPVRVALRVRPLLPKELLHGHQSCLQVEPGLGRVTLGRDRHFGFHVVLAE
DAGQEAVYQACVQPLLEAFFEGFNATVFAYGQTGSGKTYTMGEASVASLLEDEQGIVPRA
MAEAFKLIDENDLLDCLVHVSYLEVYKEEFRDLLEVGTASRDIQLREDERGNVVLCGVKE
VDVEGLDEVLSLLEMGNAARHTGATHLNHLSSRSHTVFTVTLEQRGRAPSRLPRPAPGQL
LVSKFHFVDLAGSERVLKTGSTGERLKESIQINSSLLALGNVISALGDPQRRGSHIPYRD
SKITRILKDSLGGNAKTVMIACVSPSSSDFDETLNTLNYASRAQ

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1

Primary citation

Structural Insights Into Human Kif7, a Kinesin Involved in Hedgehog Signalling. Klejnot, M., Kozielski, F. Acta Crystallogr D Biol Crystallogr (2012) 68:154. DOI 10.1107/S0907444911053042 · PubMed

Other PDB entries of the same protein (UniProt Q2M1P5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XT3 1.88 Å, Human KIF7, a kinesin involved in hedgehog signalling
7RX0 3.89 Å, Complex of AMPPNP-Kif7 and Gli2 Zinc-Finger domain bound to microtubules
6MLQ 4.2 Å, Cryo-EM structure of microtubule-bound Kif7 in the ADP state
6MLR 4.2 Å, Cryo-EM structure of microtubule-bound Kif7 in the AMPPNP state

Browse structure collections

About this viewer

MolViewer shows 4A14 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.