4A5W: C5b6

Crystal structure of C5b6. Determined by X-ray diffraction at 3.5 Å resolution. Released 14 Mar 2012.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 19,028
Mol. weight: 281.88 kDa
Ligands: MAN, FUC, CA, NAG
Released: 14 Mar 2012

Explore 4A5W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4A5W contains 65 α-helices and 165 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 40 helices, 112 β-strands

Element	Residues	Length	Sheet
β-strand	24-28	5	1
β-strand	31-32	2	2
β-strand	36-42	7	1
β-strand	52-58	7	3
β-strand	61	1	4
β-strand	63	1	4
β-strand	67-71	5	3
β-strand	80-86	7	1
α-helix	91-92	2
α-helix	98	1
β-strand	102-108	7	3
β-strand	112-117	6	3
β-strand	119-120	2	2
β-strand	125-130	6	5
β-strand	134-135	2	6
β-strand	140-148	9	5
β-strand	159-164	6	6
β-strand	170-176	7	6
β-strand	182-189	8	5
β-strand	197-204	8	6
β-strand	212-219	8	6
β-strand	227-233	7	7
α-helix	241-244	4
β-strand	247-254	8	7
α-helix	258	1
β-strand	259	1	7
α-helix	260	1
β-strand	262-272	11	8
β-strand	289-293	5	8
β-strand	296	1	8
β-strand	297-300	4	7
α-helix	303-306	4
β-strand	322-331	10	8
β-strand	337-342	6	8
β-strand	346	1	8
β-strand	353-356	4	9
β-strand	362-363	2	10
β-strand	369-376	8	9
β-strand	382	1	9
β-strand	387-396	10	10
β-strand	402-410	9	10
β-strand	418-422	5	9
β-strand	428-437	10	10
β-strand	449-456	8	10
α-helix	457-458	2
β-strand	466-467	2	11
β-strand	472	1	12
β-strand	475	1	12
β-strand	481-487	7	11
β-strand	498-505	8	13
β-strand	508-516	9	13
β-strand	524-529	6	11
α-helix	532-534	3
β-strand	537-544	8	13
β-strand	555-562	8	13
β-strand	572-575	4	14
β-strand	582	1	15
β-strand	587-593	7	14
β-strand	598-606	9	16
α-helix	614-616	3
α-helix	624-627	4
α-helix	628-630	3
α-helix	643-649	7
β-strand	651-654	4	1
β-strand	773-780	8	16
β-strand	783-789	7	14
β-strand	796-805	10	16
β-strand	808-811	4	16
α-helix	812-814	3
β-strand	815-818	4	16
β-strand	819	1	15
β-strand	823-827	5	17
β-strand	839	1	18
β-strand	842-847	6	17
β-strand	853-861	9	19
β-strand	865-867	3	18
α-helix	883-885	3
β-strand	886-888	3	19
β-strand	892-897	6	17
β-strand	900-902	3	18
β-strand	908-916	9	19
β-strand	921-927	7	19
β-strand	935-944	10	20
β-strand	945	1	21
β-strand	954	1	21
β-strand	957-959	3	22
β-strand	967	1	23
α-helix	968	1
β-strand	973-980	8	20
α-helix	994-998	5
α-helix	1011-1027	17
α-helix	1038-1057	20
β-strand	1060	1	24
β-strand	1066	1	24
α-helix	1076-1089	14
α-helix	1097-1106	10
α-helix	1107-1111	5
β-strand	1112	1	25
β-strand	1118	1	25
α-helix	1136-1156	21
α-helix	1162-1178	17
α-helix	1185-1196	12
α-helix	1203-1214	12
β-strand	1216-1219	4	26
β-strand	1225-1228	4	26
α-helix	1247-1259	13
α-helix	1264-1275	12
α-helix	1290-1306	17
β-strand	1312-1317	6	22
β-strand	1322-1327	6	22
β-strand	1338-1340	3	20
β-strand	1346-1350	5	22
β-strand	1357-1365	9	20
β-strand	1367	1	23
α-helix	1372-1375	4
β-strand	1377-1378	2	27
β-strand	1382-1384	3	28
β-strand	1400-1403	4	28
β-strand	1406	1	29
β-strand	1407-1408	2	27
β-strand	1422-1427	6	30
α-helix	1428-1429	2
β-strand	1432-1434	3	28
α-helix	1436-1444	9
β-strand	1450-1456	7	30
β-strand	1459-1464	6	30
α-helix	1472	1
β-strand	1473	1	29
α-helix	1474	1
β-strand	1477-1481	5	28
α-helix	1488-1490	3
β-strand	1491-1497	7	30
β-strand	1505-1509	5	30
β-strand	1516	1	31
β-strand	1529	1	31
α-helix	1535-1537	3
α-helix	1546-1552	7
β-strand	1559-1564	6	32
β-strand	1567	1	33
β-strand	1578	1	33
β-strand	1581-1587	7	32
β-strand	1599	1	33
β-strand	1600	1	34
β-strand	1616-1621	6	32
α-helix	1623-1624	2
β-strand	1625	1	35
α-helix	1626	1
β-strand	1636	1	35
β-strand	1637	1	34
β-strand	1644-1647	4	32
α-helix	1648-1649	2
α-helix	1659-1673	15

Chain B: 25 helices, 53 β-strands

Element	Residues	Length	Sheet
α-helix	24-26	3
β-strand	29	1	36
β-strand	42-47	6	37
β-strand	48	1	36
α-helix	54-59	6
β-strand	68-73	6	37
α-helix	77-79	3
α-helix	86	1
β-strand	87	1	38
α-helix	88-90	3
β-strand	100-103	4	39
β-strand	104	1	38
β-strand	110	1	40
β-strand	122-125	4	39
α-helix	184	1
β-strand	185-186	2	41
α-helix	187	1
β-strand	197	1	42
β-strand	220-222	3	41
β-strand	229-231	3	41
α-helix	232-233	2
β-strand	236-240	5	43
β-strand	257-259	3	43
α-helix	300-304	5
β-strand	312-327	16	43
α-helix	336-343	8
α-helix	351-361	11
β-strand	364-366	3	42
β-strand	370-381	12	43
α-helix	383-388	6
α-helix	429-432	4
β-strand	440-442	3	43
β-strand	445	1	43
α-helix	468-478	11
β-strand	481-482	2	43
β-strand	487-489	3	42
α-helix	490-494	5
α-helix	500-518	19
β-strand	526	1	44
β-strand	530	1	44
β-strand	531	1	45
α-helix	532	1
β-strand	535	1	40
β-strand	538	1	40
β-strand	542	1	45
α-helix	543-544	2
β-strand	547-548	2	46
α-helix	550-552	3
β-strand	554-555	2	46
β-strand	569	1	47
β-strand	583	1	48
β-strand	586	1	49
β-strand	588	1	47
β-strand	606	1	49
β-strand	609	1	48
β-strand	643-645	3	50
α-helix	646-649	4
β-strand	655	1	51
β-strand	661-663	3	50
β-strand	667-668	2	52
β-strand	670	1	51
β-strand	677-680	4	53
β-strand	684-685	2	52
β-strand	686	1	54
β-strand	692	1	54
β-strand	697-700	4	53
β-strand	703-705	3	55
β-strand	715-716	2	56
β-strand	721-723	3	55
β-strand	727-730	4	56
β-strand	743-745	3	56
α-helix	761-764	4
β-strand	799-800	2	57
β-strand	813-814	2	57
α-helix	815-821	7
α-helix	843-847	5
α-helix	885-891	7
α-helix	912-917	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C5	A	protein	1580	HOMO SAPIENS	P01031 (AlphaFold model)
Complement component C6	B	protein	913	HOMO SAPIENS	P13671 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4A5W_1 COMPLEMENT C5 (chains A)
QEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYPDKKFSYSSGHVHLSSENK
FQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPITYDNGFLFIHTDKPVYTPD
QSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHIGIISFPDFKIPSNPRYGM
WTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGYKNFKNFEITIKARYFYNK
VVTEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVTFDSETAVKELSYYSLEDL
NNKYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATPLFLKPGIPYPIKVQVKDS
LDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASFVLNLPSGVTVLEFNVKTD
APDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGEHLNIIVTPKSPYIDKITH
YNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRLLVYYIVTGEQTAELVSDS
VWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWVALAAVDSAVYGVQRGAKK
PLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANADDSQENDEPCKEILLHMKT
LLPVSKPEIRSYFPESWLWEVHLVPRRKQLQFALPDSLTTWEIQGVGISNTGICVADTVK
AKVFKDVFLEMNIPYSVVRGEQIQLKGTVYNYRTSGMQFCVKMSAVEGICTSESPVIDHQ
GTKSSKCVRQKVEGSSSHLVTFTVLPLEIGLHNINFSLETWFGKEILVKTLRVVPEGVKR
ESYSGVTLDPRGIYGTISRRKEFPYRIPLDLVPKTEIKRILSVKGLLVGEILSAVLSQEG
INILTHLPKGSAEAELMSVVPVFYVFHYLETGNHWNIFHSDPLIEKQKLKKKLKEGMLSI
MSYRNADYSYSVWKGGSASTWLTAFALRVLGQVNKYVEQNQNSICNSLLWLVENYQLDNG
SFKENSQYQPIKLQGTLPVEARENSLYLTAFTVIGIRKAFDICPLVKIDTALIKADNFLL
ENTLPAQSTFTLAISAYALSLGDKTHPQFRSIVSALKREALVKGNPPIYRFWKDNLQHKD
SSVPNTGTARMVETTAYALLTSLNLKDINYVNPVIKWLSEEQRYGGGFYSTQDTINAIEG
LTEYSLLVKQLRLSMDIDVSYKHKGALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGL
ATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSDYKRIVACASYKPSREESS
SGSSHAVMDISLPTGISANEEDLKALVEGVDQLFTDYQIKDGHVILQLNSIPSSDFLCVR
FRIFELFEVGFLSPATFTVYEYHRPDKQCTMFYSTSNIKIQKVCEGAACKCVEADCGQMQ
EELDLTISAETRKQTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDS
EITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSS
CQAFLANLDEFAEDIFLNGC

Sequence of entity 2 (B), FASTA

>4A5W_2 COMPLEMENT COMPONENT C6 (chains B)
CFCDHYAWTQWTSCSKTCNSGTQSRHRQIVVDKYYQENFCEQICSKQETRECNWQRCPIN
CLLGDFGPWSDCDPCIEKQSKVRSVLRPSQFGGQPCTAPLVAFQPCIPSKLCKIEEADCK
NKFRCDSGRCIARKLECNGENDCGDNSDERDCGRTKAVCTRKYNPIPSVQLMGNGFHFLA
GEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANLENVGFEVQTAEDDLKTDFYKDLTSL
GHNENQQGSFSSQGGSSFSVPIFYSSKRSENINHNSAFKQAIQASHKKDSSFIRIHKVMK
VLNFTTKAKDLHLSDVFLKALNHLPLEYNSALYSRIFDDFGTHYFTSGSLGGVYDLLYQF
SSEELKNSGLTEEEAKHCVRIETKKRVLFAKKTKVEHRCTTNKLSEKHEGSFIQGAEKSI
SLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENPAVIDFELAPIVDLVRNIPCAV
TKRNNLRKALQEYAAKFDPCQCAPCPNNGRPTLSGTECLCVCQSGTYGENCEKQSPDYKS
NAVDGQWGCWSSWSTCDATYKRSRTRECNNPAPQRGGKRCEGEKRQEEDCTFSIMENNGQ
PCINDDEEMKEVDLPEIEADSGCPQPVPPENGFIRNEKQLYLVGEDVEISCLTGFETVGY
QYFRCLPDGTWRQGDVECQRTECIKPVVQEVLTITPFQRLYRIGESIELTCPKGFVVAGP
SRYTCQGNSWTPPISNSLTCEKDTLTKLKGHCQLGQKQSGSECICMSPEEDCSHHSEDLC
VFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDGRQLEWGLERTRLSSNSTKKES
CGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKMGSSTSEKTLNICEVGTIRCAN
RKMEILHPGKCLA

Ligands and cofactors

ID	Name	Formula	Copies
MAN	alpha-D-mannopyranose	C6 H12 O6	3
FUC	alpha-L-fucopyranose	C6 H12 O5	1
CA	Calcium ion	Ca	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Primary citation

Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9. Hadders, M.A., Bubeck, D., Roversi, P. et al. Cell Rep (2012) 1:200. DOI 10.1016/J.CELREP.2012.02.003 · PubMed

Other PDB entries of the same protein (UniProt P01031 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Y6C 2.0 Å, X-ray structure analysis of human Complement Component 5 TE domain in complex with the…
5B71 2.11 Å, Crystal structure of complement C5 in complex with SKY59
4UU9 2.12 Å, Crystal structure of the human c5a in complex with MEDI7814 a neutralising antibody
7AD7 2.3 Å, Crystal structure of human complement C5 in complex with the K8 bovine knob domain…
5B4P 2.4 Å, Complex structure of human C5a and its binding repebody
4P39 2.4 Å, Crystal structure of the human C5aR antagonist C5a-A8
7OP0 2.57 Å, Crystal structure of complement C5 in complex with chemically synthesized K92 knob domain.
3HQA 2.59 Å, Crystal structure of human desarg-C5A
5HCC 2.59 Å, Ternary complex of human Complement C5 with Ornithodoros moubata OmCI and Dermacentor…
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
6RPT 2.7 Å, Structure of tick complement inhibitor CirpT1 complexed with macroglobubulin domain 4 of…
7AD6 2.75 Å, Crystal structure of human complement C5 in complex with the K92 bovine knob domain…

Browse structure collections

About this viewer

MolViewer shows 4A5W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.