Crystal structure of diphtheria toxin mutant CRM197. Determined by X-ray diffraction at 2.0 Å resolution. Released 28 Mar 2012.
Explore 4AE0 in 3D Show helices and sheets RCSB PDB PDBe
4AE0 contains 25 α-helices and 34 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6 | 1 | 1 |
| α-helix | 8-10 | 3 | |
| β-strand | 12-15 | 4 | 2 |
| β-strand | 18-23 | 6 | 2 |
| α-helix | 28-31 | 4 | |
| β-strand | 53-56 | 4 | 2 |
| α-helix | 59-64 | 6 | |
| β-strand | 67 | 1 | 3 |
| β-strand | 77 | 1 | 3 |
| β-strand | 79-84 | 6 | 2 |
| β-strand | 88-93 | 6 | 2 |
| β-strand | 94 | 1 | 1 |
| α-helix | 99-105 | 7 | |
| α-helix | 114-118 | 5 | |
| α-helix | 121-127 | 7 | |
| β-strand | 133-139 | 7 | 2 |
| β-strand | 147-151 | 5 | 2 |
| α-helix | 155-158 | 4 | |
| β-strand | 160-166 | 7 | 2 |
| α-helix | 168-170 | 3 | |
| α-helix | 176-182 | 7 | |
| α-helix | 183-186 | 4 | |
| α-helix | 206-222 | 17 | |
| α-helix | 224-230 | 7 | |
| α-helix | 240-254 | 15 | |
| α-helix | 258-260 | 3 | |
| α-helix | 261-266 | 6 | |
| α-helix | 271-273 | 3 | |
| α-helix | 275-288 | 14 | |
| α-helix | 291-294 | 4 | |
| α-helix | 297-304 | 8 | |
| α-helix | 311-314 | 4 | |
| β-strand | 316-317 | 2 | 4 |
| β-strand | 320-321 | 2 | 4 |
| α-helix | 326-347 | 22 | |
| α-helix | 354-356 | 3 | |
| α-helix | 359-376 | 18 | |
| α-helix | 380-381 | 2 | |
| β-strand | 389-391 | 3 | 5 |
| β-strand | 394-398 | 5 | 5 |
| α-helix | 402-404 | 3 | |
| β-strand | 405-407 | 3 | 6 |
| β-strand | 412-422 | 11 | 5 |
| β-strand | 427-428 | 2 | 7 |
| β-strand | 431-435 | 5 | 8 |
| β-strand | 437 | 1 | 9 |
| β-strand | 441 | 1 | 9 |
| β-strand | 442-443 | 2 | 5 |
| β-strand | 449-452 | 4 | 5 |
| β-strand | 455-458 | 4 | 5 |
| β-strand | 459-464 | 6 | 8 |
| β-strand | 468-473 | 6 | 8 |
| β-strand | 478-479 | 2 | 7 |
| β-strand | 480 | 1 | 10 |
| β-strand | 483 | 1 | 10 |
| β-strand | 485-493 | 9 | 5 |
| β-strand | 508-515 | 8 | 8 |
| β-strand | 524-530 | 7 | 8 |
| β-strand | 532-534 | 3 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Diphtheria toxin | A | protein | 535 | CORYNEBACTERIUM DIPHTHERIAE | P00588 |
>4AE0_1 DIPHTHERIA TOXIN (chains A) GADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKEFYSTDNKY DAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGT EEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYE YMAQACAGNRVRRSVGSSLSCINLDWDVIRDKTKTKIESLKEHGPIKNKMSESPNKTVSE EKAKQYLEEFHQTALEHPELSELKTVTGTNPVFAGANYAAWAVNVAQVIDSETADNLEKT TAALSILPGIGSVMGIADGAVHHNTEEIVAQSIALSSLMVAQAIPLVGELVDIGFAAYNF VESIINLFQVVHNSYNRPAYSPGHKTQPFLHDGYAVSWNTVEDSIIRTGFQGESGHDIKI TAENTPLPIAGVLLPTIPGKLDVNKSKTHISVNGRKIRMRCRAIDGDVTFCRPKSPVYVG NGVHANLHVAFHRSSSEKIHSNEISSDSIGVLGYQKTVDHTKVNSKLSLFFEIKS
Structural Basis for Lack of Toxicity of the Diphtheria Toxin Mutant Crm197. Malito, E., Bursulaya, B., Chen, C. et al. Proc Natl Acad Sci U S A (2012) 109:5229. DOI 10.1073/PNAS.1201964109 · PubMed
Other PDB entries of the same protein (UniProt P00588), best resolution first:
MolViewer shows 4AE0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.