Human Aurora B Kinase in complex with INCENP and VX-680. Determined by X-ray diffraction at 2.75 Å resolution. Released 11 Apr 2012.
Explore 4AF3 in 3D Show helices and sheets RCSB PDB PDBe
4AF3 contains 19 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 74-76 | 3 | |
| β-strand | 77-82 | 6 | 1 |
| β-strand | 86 | 1 | 2 |
| β-strand | 89 | 1 | 2 |
| β-strand | 90-96 | 7 | 1 |
| β-strand | 102-109 | 8 | 1 |
| α-helix | 110-116 | 7 | |
| α-helix | 119-130 | 12 | |
| β-strand | 137 | 1 | 3 |
| α-helix | 138-139 | 2 | |
| β-strand | 140-145 | 6 | 1 |
| β-strand | 149-155 | 7 | 1 |
| β-strand | 161 | 1 | 3 |
| α-helix | 162-169 | 8 | |
| α-helix | 174-193 | 20 | |
| α-helix | 203-205 | 3 | |
| β-strand | 206-208 | 3 | 3 |
| β-strand | 214-216 | 3 | 3 |
| α-helix | 242-245 | 4 | |
| α-helix | 253-268 | 16 | |
| α-helix | 278-286 | 9 | |
| α-helix | 298-307 | 10 | |
| α-helix | 312-314 | 3 | |
| α-helix | 316-317 | 2 | |
| α-helix | 318-322 | 5 | |
| α-helix | 325-330 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 844-846 | 3 | |
| α-helix | 848-860 | 13 | |
| α-helix | 865-869 | 5 | |
| α-helix | 873-875 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Aurora kinase B | A | protein | 292 | HOMO SAPIENS | Q96GD4 (AlphaFold model) |
| Inner centromere protein | D | protein | 71 | HOMO SAPIENS | Q9NQS7 (AlphaFold model) |
>4AF3_1 AURORA KINASE B (chains A) SMQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQ IEKEGVEHQLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTF DEQRTATIMEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKT MCGTLDYLPPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKF PASVPTGAQDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
>4AF3_2 INNER CENTROMERE PROTEIN (chains D) SMEAHPRKPIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKRT SSAVWNSPPLQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| VX6 | Cyclopropanecarboxylic acid {4-[4-(4-methyl-piperazin-1-yl)-6-(5-methyl-2H-pyra… | C23 H28 N8 O S | 1 |
Crystal Structure of Human Aurora B in Complex with Incenp and Vx-680. Elkins, J.M., Santaguida, S., Musacchio, A. et al. J Med Chem (2012) 55:7841. DOI 10.1021/JM3008954 · PubMed
MolViewer shows 4AF3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.