4ATM: BAR domain of human Amphiphysin, isoform 1

Crystal structure of the BAR domain of human Amphiphysin, isoform 1 at 1.8 Angstrom resolution featuring increased order at the N- terminus. Determined by X-ray diffraction at 1.78 Å resolution. Released 30 May 2012.

Method: X-ray diffraction
Resolution: 1.78 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 2,107
Mol. weight: 29.04 kDa
Released: 30 May 2012

Explore 4ATM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ATM contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	20-22	3
α-helix	24-84	61
α-helix	92-113	22
α-helix	114-118	5
α-helix	119-126	8
α-helix	128-156	29
α-helix	163-196	34
α-helix	198-237	40

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Amphiphysin	A	protein	243	HOMO SAPIENS	P49418 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4ATM_1 AMPHIPHYSIN (chains A)
SMADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQRE
LRGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDESLL
TLDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKV
FEEFNVDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQHA
DKA

Primary citation

Crystal Structure of the Bar Domain of Human Amphiphysin, Isoform 1. Allerston, C.K., Krojer, T., Gileadi, O. To be published.

Other PDB entries of the same protein (UniProt P49418 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M61 1.84 Å, Clathrin heavy chain N-terminal domain bound to an extended amphiphysin clathrin-box motif
5M5S 1.88 Å, Clathrin heavy chain N-terminal domain bound to amphiphysin clathrin-box motif
1KY7 2.15 Å, The ap-2 clathrin adaptor alpha-appendage in complex with amphiphysin fxdxf
1UTC 2.3 Å, Clathrin terminal domain complexed with TLPWDLWTT
3SOG 2.3 Å, Crystal structure of the BAR domain of human Amphiphysin, isoform 1

Browse structure collections

About this viewer

MolViewer shows 4ATM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.