4B3N: Rhesus TRIM5alpha PRY/SPRY domain

Crystal structure of rhesus TRIM5alpha PRY/SPRY domain. Determined by X-ray diffraction at 3.3 Å resolution. Released 24 Oct 2012.

Method: X-ray diffraction
Resolution: 3.3 Å
Organisms: ESCHERICHIA COLI, MACACA MULATTA
Chains: 2
Atoms: 8,860
Mol. weight: 135.61 kDa
Released: 24 Oct 2012

Explore 4B3N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4B3N contains 50 α-helices and 80 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 40 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	1
α-helix	17-31	15
β-strand	35-38	4	1
α-helix	43-53	11
β-strand	59-63	5	1
α-helix	64-66	3
α-helix	67-73	7
β-strand	76	1	2
α-helix	83-88	6
β-strand	89	1	3
α-helix	91-96	6
β-strand	98-99	2	4
β-strand	102-103	2	4
β-strand	105-111	7	1
β-strand	114-118	5	5
β-strand	128	1	6
α-helix	131-140	10
β-strand	145-147	3	5
α-helix	154-163	10
β-strand	167-172	6	7
β-strand	175-182	8	7
α-helix	186-200	15
α-helix	210-218	9
β-strand	222-227	6	5
α-helix	229-231	3
α-helix	232-238	7
β-strand	242-245	4	5
α-helix	246-248	3
β-strand	249-250	2	6
β-strand	253-254	2	6
β-strand	258-259	2	8
β-strand	260-266	7	1
β-strand	267	1	2
α-helix	273-278	6
α-helix	279-284	6
α-helix	287-296	10
β-strand	301-302	2	1
β-strand	304	1	3
α-helix	305-311	7
α-helix	315-326	12
β-strand	328-329	2	8
α-helix	330-331	2
α-helix	336-351	16
α-helix	357-369	13
α-helix	1291-1297	7
β-strand	1300	1	9
β-strand	1305-1306	2	10
β-strand	1314-1315	2	9
β-strand	1321-1323	3	9
β-strand	1352-1354	3	10
β-strand	1358	1	11
β-strand	1362-1368	7	9
β-strand	1375-1380	6	10
α-helix	1391-1394	4
α-helix	1399-1401	3
β-strand	1403-1409	7	10
β-strand	1413-1418	6	10
β-strand	1429-1432	4	10
β-strand	1441-1447	7	9
β-strand	1452-1457	6	9
β-strand	1463-1468	6	9
β-strand	1477	1	11
β-strand	1478-1482	5	10
β-strand	1490-1492	3	9

Chain B: 26 helices, 40 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	12
α-helix	17-31	15
β-strand	35-38	4	12
α-helix	43-53	11
β-strand	59-63	5	12
α-helix	64-66	3
α-helix	67-73	7
β-strand	76	1	13
α-helix	83-88	6
β-strand	89	1	14
α-helix	91-96	6
β-strand	98-99	2	15
β-strand	102-103	2	15
β-strand	105-111	7	12
β-strand	114-118	5	16
β-strand	128	1	17
α-helix	131-140	10
β-strand	145-147	3	16
α-helix	154-163	10
β-strand	167-172	6	18
β-strand	175-182	8	18
α-helix	186-200	15
α-helix	210-218	9
β-strand	222-227	6	16
α-helix	229-231	3
α-helix	232-238	7
β-strand	242-245	4	16
α-helix	246-248	3
β-strand	249-250	2	17
β-strand	253-254	2	17
β-strand	258-259	2	19
β-strand	260-266	7	12
β-strand	267	1	13
α-helix	273-278	6
α-helix	279-284	6
α-helix	287-296	10
β-strand	301-302	2	12
β-strand	304	1	14
α-helix	305-311	7
α-helix	315-326	12
β-strand	328-329	2	19
α-helix	330-331	2
α-helix	336-351	16
α-helix	357-369	13
α-helix	1291-1297	7
β-strand	1300	1	20
β-strand	1305-1306	2	21
α-helix	1307	1
β-strand	1314-1315	2	20
β-strand	1321-1323	3	20
β-strand	1352-1354	3	21
β-strand	1358	1	22
β-strand	1362-1368	7	20
β-strand	1375-1380	6	21
α-helix	1391-1394	4
α-helix	1399-1401	3
β-strand	1403-1409	7	21
β-strand	1413-1418	6	21
α-helix	1428	1
β-strand	1429-1432	4	21
β-strand	1441-1447	7	20
β-strand	1452-1457	6	20
β-strand	1463-1468	6	20
β-strand	1477	1	22
β-strand	1478-1482	5	21
β-strand	1490-1492	3	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose-binding periplasmic protein, tripartite motif-containing protein 5	A, B	protein	602	ESCHERICHIA COLI, MACACA MULATTA	P0AEX9 (AlphaFold model), Q0PF16 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4B3N_1 MALTOSE-BINDING PERIPLASMIC PROTEIN, TRIPARTITE MOTIF-CONTAINING PROTEIN 5 (chains A, B)
MNTIHHHHHHNTSMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEK
FPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAY
PIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGG
YAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTI
NGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGIDAASPNKELAKEFLENYLLT
DEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTA
VINAASGRQTVDEALKDAQTRITRRVFRAPDLKGMLDMFRELTDARRYWVDVTLATNNIS
HAVIAEDKRQVSSRNPQIMYQAPGTLFTFPSLTNFNYCTGVLGSQSITSGKHYWEVDVSK
KSAWILGVCAGFQSDAMYNIEQNENYQPKYGYWVIGLQEGVKYSVFQDGSSHTPFAPFIV
PLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMT
LC

Primary citation

Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha. Yang, H., Ji, X., Zhao, G. et al. Proc Natl Acad Sci U S A (2012) 109:18372. DOI 10.1073/PNAS.1210903109 · PubMed

Other PDB entries of the same protein (UniProt P0AEX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8C8F 1.15 Å, Crystal structure of the E. coli maltodextrin-binding protein
4EXK 1.28 Å, A chimera protein containing MBP fused to the C-terminal domain of the uncharacterized…
3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
7KD4 1.31 Å, Structure of the C-terminal domain of the Menangle virus phosphoprotein (residues 329…
5M13 1.37 Å, Synthetic nanobody in complex with MBP
5HZ7 1.43 Å, High-resolution crystal structure of the minor DNA-binding pilin ComP from Neisseria…
5H7Q 1.45 Å, Crystal structure of human MNDA PYD domain with MBP tag
6XDS 1.47 Å, Crystal structure of MBP-TREM2 Ig domain fusion with fragment,…
4IRL 1.47 Å, X-ray structure of the CARD domain of zebrafish GBP-NLRP1 like protein
8SVY 1.47 Å, MBP-Mcl1 in complex with ligand 10
3MP6 1.48 Å, Complex Structure of Sgf29 and dimethylated H3K4
9CLC 1.48 Å, Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Cyanotryptophan

Browse structure collections

About this viewer

MolViewer shows 4B3N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.