4B4S: Pro-survival Bcl-2:Bim BH3 complex

Crystal Structure of a pro-survival Bcl-2:Bim BH3 complex. Determined by X-ray diffraction at 1.9 Å resolution. Released 16 Jan 2013.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,457
Mol. weight: 23.11 kDa
Released: 16 Jan 2013

Explore 4B4S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4B4S contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	3-19	17
α-helix	22	1
α-helix	26-30	5
α-helix	33-48	16
α-helix	50-54	5
α-helix	63-76	14
α-helix	83-97	15
α-helix	101-104	4
α-helix	122-140	19
α-helix	143-148	6
α-helix	151-159	9

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	54-73	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-2-like protein 10	A	protein	175	HOMO SAPIENS	Q9HD36 (AlphaFold model)
Bcl-2-like protein 11	B	protein	28	HOMO SAPIENS	O43521 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4B4S_1 BCL-2-LIKE PROTEIN 10 (chains A)
GGSADPLRERTELLLADYLGYSAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYL
GYPGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLK
EQEGDVARDSQRLVALLSSRLMGQHRAWLQAQGGWDGFSHFFRTPFPLAENLYFQ

Sequence of entity 2 (B), FASTA

>4B4S_2 BCL-2-LIKE PROTEIN 11 (chains B)
GSDMRPEIWIAQELRRIGDEFNAYYARR

Primary citation

The Restricted Binding Repertoire of Bcl-B Leaves Bim as the Universal Bh3-Only Prosurvival Bcl-2 Protein Antagonist. Rautureau, G.J.P., Yabal, M., Yang, H. et al. Cell Death Dis (2012) 3:E443. DOI 10.1038/CDDIS.2012.178 · PubMed

Browse structure collections

About this viewer

MolViewer shows 4B4S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.