High resolution NMR structure of the C mu3 domain from IgM. Determined by solution NMR. Released 12 Jun 2013.
Explore 4BA8 in 3D Show helices and sheets RCSB PDB PDBe
4BA8 contains 5 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-9 | 5 | 1 |
| α-helix | 10-12 | 3 | |
| α-helix | 13-19 | 7 | |
| β-strand | 22-29 | 8 | 1 |
| β-strand | 38-43 | 6 | 2 |
| α-helix | 47 | 1 | |
| β-strand | 48 | 1 | 2 |
| α-helix | 49 | 1 | |
| β-strand | 51-52 | 2 | 1 |
| β-strand | 66-72 | 7 | 1 |
| α-helix | 74-78 | 5 | |
| β-strand | 83-88 | 6 | 2 |
| β-strand | 96-100 | 5 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ig mu chain C region secreted form | A | protein | 102 | MUS MUSCULUS | P01872 (AlphaFold model) |
>4BA8_1 IG MU CHAIN C REGION SECRETED FORM (chains A) MGDILTFTIPPSFADIFLSKSANLTCLVSNLATYETLNISWASQSGEPLETKIKVMESHP NGTFSAKGVASVSVEDWNNRKEFVCTVTHRDLPSPQKKFISK
High Resolution Structures of the Igm Fc Domains Reveal Principles of its Hexamer Formation. Mueller, R., Graewert, M.A., Kern, T. et al. Proc Natl Acad Sci U S A (2013) 110:10183. DOI 10.1073/PNAS.1300547110 · PubMed
Other PDB entries of the same protein (UniProt P01872 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4BA8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.