4JVW: IgM C4-domain from mouse

IgM C4-domain from mouse. Determined by X-ray diffraction at 2.0 Å resolution. Released 12 Jun 2013.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Mus musculus
Chains: 4
Atoms: 3,785
Mol. weight: 50.97 kDa
Released: 12 Jun 2013

Explore 4JVW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JVW contains 28 α-helices and 42 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	450	1	1
α-helix	451-452	2
β-strand	453-457	5	2
α-helix	458-460	3
α-helix	461-464	4
β-strand	469-479	11	2
β-strand	480	1	1
β-strand	485-490	6	3
β-strand	493-494	2	3
α-helix	495-496	2
α-helix	497-499	3
β-strand	501-502	2	2
α-helix	503-505	3
β-strand	506-507	2	2
β-strand	515-524	10	2
α-helix	525-529	5
β-strand	534-539	6	3
β-strand	547-552	6	3

Chain B: 8 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	450	1	4
α-helix	451-452	2
β-strand	453-457	5	5
α-helix	458-460	3
α-helix	461-464	4
β-strand	469-479	11	5
β-strand	480	1	4
β-strand	485-490	6	6
β-strand	493-494	2	6
α-helix	495-496	2
α-helix	497-499	3
β-strand	501-502	2	5
α-helix	503-505	3
β-strand	506-507	2	5
α-helix	508	1
β-strand	515-524	10	5
α-helix	525-530	6
β-strand	534-539	6	6
β-strand	547-552	6	6

Chain C: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	450	1	7
β-strand	453-457	5	8
α-helix	461-466	6
β-strand	469-479	11	8
β-strand	480	1	7
β-strand	485-490	6	9
β-strand	493-494	2	9
α-helix	495-496	2
α-helix	497-499	3
β-strand	500-502	3	8
α-helix	503-505	3
β-strand	506-507	2	8
α-helix	508	1
β-strand	515-524	10	8
α-helix	525-529	5
β-strand	534-539	6	9
β-strand	547-552	6	9

Chain D: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	451-452	2
β-strand	453-457	5	10
α-helix	458-460	3
β-strand	469-479	11	10
β-strand	485-490	6	11
β-strand	493-494	2	11
α-helix	495-496	2
α-helix	497-499	3
β-strand	500-502	3	10
α-helix	503-505	3
β-strand	506-507	2	10
α-helix	508	1
β-strand	515-524	10	10
α-helix	525-529	5
β-strand	534-539	6	11
β-strand	547-552	6	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ig mu chain C region secreted form	A, B, C, D	protein	115	Mus musculus	P01872 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4JVW_1 Ig mu chain C region secreted form (chains A, B, C, D)
MGEVHKHPPAVYLLPPAREQLNLRESATVTCLVKGFSPADISVQWLQRGQLLPQEKYVTS
APMPEPGAPGFYFTHSILTVTEEEWNSGETYTCVVGHEALPHLVTERTVDKSTGK

Primary citation

High-resolution structures of the IgM Fc domains reveal principles of its hexamer formation. Muller, R., Grawert, M.A., Kern, T. et al. Proc Natl Acad Sci U S A (2013) 110:10183-10188. DOI 10.1073/pnas.1300547110 · PubMed

Other PDB entries of the same protein (UniProt P01872 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JVU 1.3 Å, IgM C2-domain from mouse
8E4C 4.0 Å, IgM BCR fab truncated form
8EMA 8.2 Å, mouse full length B cell receptor
4BA8 High resolution NMR structure of the C mu3 domain from IgM

Browse structure collections

About this viewer

MolViewer shows 4JVW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.