4BEX: Human Cofilin1

Structure of human Cofilin1. Determined by X-ray diffraction at 2.8 Å resolution. Released 28 Aug 2013.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,310
Mol. weight: 19.71 kDa
Released: 28 Aug 2013

Explore 4BEX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BEX contains 9 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 1: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	1
α-helix	9-18	10
β-strand	33-40	8	1
β-strand	46-56	11	1
α-helix	58-59	2
α-helix	60-64	5
α-helix	67-74	8
β-strand	81-90	10	1
β-strand	95-104	10	1
α-helix	111-119	9
α-helix	121-125	5
β-strand	133-137	5	1
α-helix	140-143	4
α-helix	146-154	9
α-helix	155-157	3
β-strand	160-161	2	1
β-strand	164-165	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cofilin-1	1	protein	181	HOMO SAPIENS	P23528 (AlphaFold model)

Sequence of entity 1 (1), FASTA

>4BEX_1 COFILIN-1 (chains 1)
GSPGISGGGGGILDSMASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKK
NIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWA
PESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRATLAEKLGGSAVISLEGKP
L

Primary citation

Analysis of the Human Cofilin1 Structure Reveals Conformational Changes Required for Actin-Binding. Klejnot, M., Gabrielsen, M., Cameron, J. et al. Acta Crystallogr D Biol Crystallogr (2013) 69:1780. DOI 10.1107/S0907444913014418 · PubMed

Other PDB entries of the same protein (UniProt P23528 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9H1F 1.8 Å, Cofilin-1 in complex with high-affinity Sybody B12
9QFJ 2.31 Å, Cryo-EM structure of the cofilactin filament core at 2.3 Angstrom resolution.
5L6W 2.53 Å, Structure Of the LIMK1-ATPgammaS-CFL1 Complex
9QFD 2.61 Å, Cryo-EM structure of the fully cofilin-1-decorated actin filament (cofilactin)
9QFQ 2.76 Å, Cryo-EM structure of the cofilactin barbed end bound by AIP1
9QFO 2.96 Å, Cryo-EM structure of the cofilactin filament pointed end
9QFE 3.12 Å, Cryo-EM structure of the actin filament hetero-decorated by Coronin-1 and Cofilin-1 on…
9QFW 3.16 Å, Cryo-EM structure of the cofilactin barbed end bound by two AIP1 molecules
6VAO 3.4 Å, Human cofilin-1 decorated actin filament
9QFG 3.49 Å, Cryo-EM structure of the actin filament hetero-decorated by Coronin-1 and Cofilin-1,…
5HVK 3.5 Å, Crystal structure of LIMK1 mutant D460N in complex with full-length cofilin-1
9QFK 3.99 Å, Cryo-EM structure of the Coronin-1B-decorated actin filament bound by one Cofilin-1…

Browse structure collections

About this viewer

MolViewer shows 4BEX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.