Crystal structure of the C-terminal region of human ZFYVE9. Determined by X-ray diffraction at 2.53 Å resolution. Released 15 May 2013.
Explore 4BKW in 3D Show helices and sheets RCSB PDB PDBe
4BKW contains 23 α-helices and 33 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 904-906 | 3 | |
| β-strand | 907-909 | 3 | 1 |
| β-strand | 918-920 | 3 | 1 |
| α-helix | 925-932 | 8 | |
| α-helix | 938-939 | 2 | |
| β-strand | 940-945 | 6 | 1 |
| β-strand | 948-957 | 10 | 1 |
| β-strand | 960-968 | 9 | 1 |
| α-helix | 971-973 | 3 | |
| β-strand | 977-983 | 7 | 1 |
| α-helix | 984-985 | 2 | |
| α-helix | 994-1007 | 14 | |
| β-strand | 1017-1019 | 3 | 1 |
| β-strand | 1024 | 1 | 2 |
| β-strand | 1027 | 1 | 2 |
| β-strand | 1030-1036 | 7 | 1 |
| α-helix | 1048-1049 | 2 | |
| β-strand | 1053-1060 | 8 | 1 |
| α-helix | 1064-1069 | 6 | |
| α-helix | 1071-1082 | 12 | |
| β-strand | 1090-1091 | 2 | 1 |
| α-helix | 1095-1097 | 3 | |
| α-helix | 1106-1109 | 4 | |
| β-strand | 1122 | 1 | 3 |
| β-strand | 1127-1131 | 5 | 4 |
| β-strand | 1134-1140 | 7 | 4 |
| α-helix | 1141-1143 | 3 | |
| α-helix | 1144-1152 | 9 | |
| β-strand | 1158-1162 | 5 | 3 |
| β-strand | 1171-1177 | 7 | 4 |
| β-strand | 1183-1189 | 7 | 4 |
| α-helix | 1193-1195 | 3 | |
| β-strand | 1198-1199 | 2 | 4 |
| β-strand | 1202-1206 | 5 | 3 |
| β-strand | 1218-1222 | 5 | 3 |
| β-strand | 1225-1229 | 5 | 3 |
| α-helix | 1232-1243 | 12 | |
| β-strand | 1248-1249 | 2 | 4 |
| β-strand | 1263-1269 | 7 | 4 |
| α-helix | 1271-1273 | 3 | |
| α-helix | 1276 | 1 | |
| β-strand | 1280 | 1 | 5 |
| β-strand | 1287 | 1 | 5 |
| β-strand | 1292-1295 | 4 | 6 |
| β-strand | 1302-1304 | 3 | 6 |
| β-strand | 1307-1316 | 10 | 6 |
| α-helix | 1334-1347 | 14 | |
| α-helix | 1348-1350 | 3 | |
| α-helix | 1351-1356 | 6 | |
| β-strand | 1361-1368 | 8 | 6 |
| β-strand | 1373-1379 | 7 | 6 |
| β-strand | 1382 | 1 | 6 |
| α-helix | 1383-1385 | 3 | |
| α-helix | 1386-1388 | 3 | |
| α-helix | 1389-1400 | 12 | |
| β-strand | 1413-1422 | 10 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Zinc finger fyve domain-containing protein 9 | A | protein | 531 | HOMO SAPIENS | O95405 (AlphaFold model) |
>4BKW_1 ZINC FINGER FYVE DOMAIN-CONTAINING PROTEIN 9 (chains A) AMNLIPEDGLPPILISTGVKGDYAVEEKPSQISVMQQLEDGGPDPLVFVLNANLLSMVKI VNYVNRKCWCFTTKGMHAVGQSEIVILLQCLPDEKCLPKDIFNHFVQLYRDALAGNVVSN LGHSFFSQSFLGSKEHGGFLYVTSTYQSLQDLVLPTPPYLFGILIQKWETPWAKVFPIRL MLRLGAEYRLYPCPLFSVRFRKPLFGETGHTIMNLLADFRNYQYTLPVVQGLVVDMEVRK TSIKIPSNRYNEMMKAMNKSNEHVLAGGACFNEKADSHLVCVQNDDGNYQTQAISIHNQP RKVTGASFFVFSGALKSSSGYLAKSSIVEDGVMVQITAENMDSLRQALREMKDFTITCGK ADAEEPQEHIHIQWVDDDKNVSKGVVSPIDGKSMETITNVKIFHGSEYKANGKVIRWTEV FFLENDDQHNCLSDPADHSRLTEHVAKAFCLALCPHLKLLKEDGMTKLGLRVTLDSDQVG YQAGSNGQPLPSQYMNDLDSALVPVIHGGACQLSEGPVVMELIFYILENIV
Crystal Structure of the C-Terminal Region of Human Zfyve9. Williams, E. Ph D Thesis (2013).
Other PDB entries of the same protein (UniProt O95405 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4BKW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.