4BOG: Acetylcholine receptor beta subunit

The structure and super-organization of acetylcholine receptor-rapsyn complexes. Determined by electron microscopy at 50.0 Å resolution. Released 26 Jun 2013.

Method: Electron microscopy
Resolution: 50.0 Å
Organism: Torpedo marmorata
Chains: 30
Atoms: 89,544
Mol. weight: 1679.7 kDa
Released: 26 Jun 2013

Explore 4BOG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BOG contains 330 α-helices and 432 β-strands across 30 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains 0, B, G, L, Q and V: 9 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	4-14	11
β-strand	30-34	5	1
β-strand	37-44	8	2
β-strand	49-55	7	2
β-strand	57-61	5	1
β-strand	77-81	5	1
β-strand	90-92	3	3
β-strand	100-101	2	2
β-strand	107-111	5	1
β-strand	115-118	4	1
β-strand	121-126	6	2
β-strand	143-148	6	3
β-strand	153	1	4
β-strand	157-159	3	1
β-strand	187-188	2	5
β-strand	193-195	3	3
β-strand	204	1	4
β-strand	207-210	4	3
β-strand	213-214	2	5
α-helix	221-226	6
α-helix	227-231	5
α-helix	232-240	9
α-helix	248-274	27
α-helix	282-306	25
α-helix	404-429	26
α-helix	433-461	29
α-helix	463-465	3

Chains 1, C, H, M, R and W: 10 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	4-11	8
β-strand	32-46	15	8
β-strand	51-63	13	8
α-helix	71-75	5
β-strand	80-82	3	8
α-helix	84-86	3
β-strand	92-94	3	9
β-strand	103	1	8
β-strand	110-112	3	8
β-strand	117-120	4	8
β-strand	123-128	6	8
α-helix	133-135	3
β-strand	143-150	8	9
β-strand	159-161	3	8
α-helix	180-182	3
β-strand	190-194	5	9
β-strand	197-201	5	9
β-strand	213-223	11	9
α-helix	228-253	26
α-helix	257-283	27
α-helix	289-314	26
α-helix	422-448	27
α-helix	453-479	27

Chains 2, D, I, N, S and X: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	4-13	10
β-strand	30-32	3	14
β-strand	37-44	8	15
β-strand	49-55	7	15
β-strand	58-60	3	14
α-helix	63-65	3
α-helix	72-75	4
β-strand	78-81	4	16
α-helix	82-84	3
β-strand	90-92	3	17
β-strand	101	1	15
β-strand	107-110	4	16
β-strand	116-118	3	14
β-strand	121-127	7	15
β-strand	141-148	8	17
β-strand	157-159	3	14
α-helix	167-169	3
β-strand	177-187	11	17
β-strand	199-208	10	17
α-helix	213-239	27
α-helix	240-242	3
α-helix	243-270	28
α-helix	275-277	3
α-helix	278-300	23
α-helix	375-400	26
α-helix	405-435	31

Chains 3, E, J, O, T and Y: 14 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
β-strand	30-43	14	21
β-strand	48-60	13	21
α-helix	62-64	3
β-strand	77	1	21
α-helix	81-83	3
β-strand	89-91	3	22
β-strand	100	1	21
β-strand	108-109	2	21
β-strand	114-117	4	21
β-strand	120-125	6	21
α-helix	139	1
β-strand	140	1	23
α-helix	141	1
β-strand	143-147	5	22
β-strand	157-158	2	21
α-helix	173-175	3
β-strand	183-187	5	23
β-strand	192-193	2	22
β-strand	207-210	4	22
β-strand	213-216	4	23
α-helix	222-245	24
α-helix	248-250	3
α-helix	251-278	28
α-helix	284-306	23
α-helix	415-441	27
α-helix	444-461	18
α-helix	462-466	5
α-helix	467-473	7

Chains A, F, K, P, U and Z: 10 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	4-13	10
β-strand	29-44	16	26
β-strand	49-60	12	26
α-helix	72-75	4
β-strand	78-81	4	26
α-helix	82-84	3
β-strand	90-92	3	27
β-strand	100-101	2	26
β-strand	107-110	4	26
β-strand	116-118	3	26
β-strand	121-127	7	26
β-strand	140-148	9	27
β-strand	156-159	4	26
β-strand	177-187	11	27
β-strand	199-208	10	27
α-helix	213-238	26
α-helix	240-242	3
α-helix	243-270	28
α-helix	275-277	3
α-helix	278-300	23
α-helix	375-398	24
α-helix	406-435	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acetylcholine receptor beta subunit	0, B, G, L, Q, V	protein	493	Torpedo marmorata	Q6S3I0 (AlphaFold model)
Acetylcholine receptor delta subunit	1, C, H, M, R, W	protein	522	Torpedo marmorata	Q6S3H8 (AlphaFold model)
Acetylcholine receptor subunit alpha	2, A, D, F, I, K, N, P, S, U, X, Z	protein	461	Torpedo marmorata	P02711 (AlphaFold model)
Acetylcholine receptor gamma subunit	3, E, J, O, T, Y	protein	505	Torpedo marmorata	Q6S3H9 (AlphaFold model)

Sequence of entity 1 (0, B, G, L, Q, V), FASTA

>4BOG_1 Acetylcholine receptor beta subunit (chains 0, B, G, L, Q, V)
MEDVRRMALGLVVMMALALSGVGASVMEDTLLSVLFENYNPKVRPSQTVGDKVTVRVGLT
LTSLLILNEKNEEMTTSVFLNLAWTDYRLQWDPAAYEGIKDLSIPSDDVWQPDIVLMNNN
DGSFEITLHVNVLVQHTGAVSWHPSAIYRSSCTIKVMYFPFDWQNCTMVFKSYTYDTSEV
ILQHALDAKGEREVKEIMINQDAFTENGQWSIEHKPSRKNWRSDDPSYEDVTFYLIIQRK
PLFYIVYTIVPCILISILAILVFYLPPDAGEKMSLSISALLALTVFLLLLADKVPETSLS
VPIIISYLMFIMILVAFSVILSVVVLNLHHRSPNTHTMPNWIRQIFIETLPPFLWIQRPV
TTPSPDSKPTIISRANDEYFIRKPAGDFVCPVDNARVAVQPERLFSEMKWHLNGLTQPVT
LPQDLKEAVEAIKYIAEQLESASEFDDLKKDWQYVAMVADRLFLYIFITMCSIGTFSIFL
DASHNVPPDNPFA

Sequence of entity 2 (1, C, H, M, R, W), FASTA

>4BOG_2 Acetylcholine receptor delta subunit (chains 1, C, H, M, R, W)
MGNIHFVYLLISCLYYSGCSGVNEEERLINDLLIVNKYNKHVRPVKHNNEVVNIALSLTL
SNLISLKETDETLTTNVWMDHAWYDHRLTWNASEYSDISILRLRPELIWIPDIVLQNNND
GQYNVAYFCNVLVRPNGYVTWLPPAIFRSSCPINVLYFPFDWQNCSLKFTALNYNANEIS
MDLMTDTIDGKDYPIEWIIIDPEAFTENGEWEIIHKPAKKNIYGDKFPNGTNYQDVTFYL
IIRRKPLFYVINFITPCVLISFLAALAFYLPAESGEKMSTAICVLLAQAVFLLLTSQRLP
ETALAVPLIGKYLMFIMSLVTGVVVNCGIVLNFHFRTPSTHVLSTRVKQIFLEKLPRILH
MSRVDEIEQPDWQNDLKLRRSSSVGYISKAQEYFNIKSRSELMFEKQSERHGLVPRVTPR
IGFGNNNENIAASDQLHDEIKSGIDSTNYIVKQIKEKNAYDEEVGNWNLVGQTIDRLSMF
IITPVMVLGTIFIFVMGNFNRPPAKPFEGDPFDYSSDHPRCA

Sequence of entity 3 (2, A, D, F, I, K, N, P, S, U, X, Z), FASTA

>4BOG_3 Acetylcholine receptor subunit alpha (chains 2, A, D, F, I, K, N, P, S, U, X, Z)
MILCSYWHVGLVLLLFSCCGLVLGSEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQ
LIQLINVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNA
DGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKV
SISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRIPLYFVV
NVIIPCLLFSFLTVLVFYLPTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGK
YMLFTMIFVISSIIVTVVVINTHHRSPSTHTMPQWVRKIFINTIPNVMFFSTMKRASKEK
QENKIFADDIDISDISGKQVTGEVIFQTPLIKNPDVKSAIEGVKYIAEHMKSDEESSNAA
EEWKYVAMVIDHILLCVFMLICIIGTVSVFAGRLIELSQEG

Sequence of entity 4 (3, E, J, O, T, Y), FASTA

>4BOG_4 Acetylcholine receptor gamma subunit (chains 3, E, J, O, T, Y)
MVLTLLLIICLALEVRSNEEGRLIEKLLGDYDKRIKPAKTLDHVIDVTLKLTLTNLISLN
EKEEALTTNVWIEIQWNDYRLSWNTSEYEGIDLVRIPSELLWLPDVVLENNVDGQFEVAY
YANVLVYNDGSMYWLPPAIYRSTCPIAVTYFPFDWQNCSLVFRSQTYNAHEVNLQLSAEE
GEVVEWIHIDPEDFTENGEWTIRHRPAKKNYNWQLTKDDIDFQEIIFFLIIQRKPLFYII
NIIAPCVLISSLVVLVYFLPAQAGGQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIG
KYLIFVMFVSLVIVTNCVIVLNVSLRTPNTHSLSEKIKHLFLEFLPKYLGMHLEPSEETP
EKPQPRRRSSFGIMIKAEEYILKKPRSELMFEEQKDRHGLKRVNKMTSDIDIGTTVDLYK
DLANFAPEIKSCVEACNFIAKSTKEQNDSGSENENWVLIGKVIDKACFWIALLLFSLGTL
AIFLTGHLNQVPEFPFPGDPRKYVP

Primary citation

Structure and Superorganization of Acetylcholine Receptor-Rapsyn Complexes. Zuber, B., Unwin, N. Proc Natl Acad Sci U S A (2013) 110:10622. DOI 10.1073/PNAS.1301277110 · PubMed

Other PDB entries of the same protein (UniProt Q6S3I0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BG9 4.0 Å, Refined structure of the nicotinic acetylcholine receptor at 4A resolution.
4AQ5 6.2 Å, Gating movement in acetylcholine receptor analysed by time-resolved electron…
4AQ9 6.2 Å, Gating movement in acetylcholine receptor analysed by time- resolved electron…
4BON 40.0 Å, The structure and super-organization of acetylcholine receptor-rapsyn complexes class B
4BOI 41.0 Å, The structure and super-organization of acetylcholine receptor-rapsyn complexes class A
4BOO 42.0 Å, The structure and super-organization of acetylcholine receptor-rapsyn complexes class C
4BOR 42.0 Å, The structure and super-organization of acetylcholine receptor-rapsyn complexes class D
4BOT 42.0 Å, The structure and super-organization of acetylcholine receptor- rapsyn complexes class E

Browse structure collections

About this viewer

MolViewer shows 4BOG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.