HIF prolyl hydroxylase 2 (PHD2/ EGLN1) in complex with Fe(II) and N-[(1-chloro-4-hydroxyisoquinolin-3-yl)carbonyl]alanine. Determined by X-ray diffraction at 1.53 Å resolution. Released 19 Jun 2013.
Explore 4BQY in 3D Show helices and sheets RCSB PDB PDBe
4BQY contains 9 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 190-193 | 4 | |
| α-helix | 194-198 | 5 | |
| α-helix | 199-205 | 7 | |
| β-strand | 207-210 | 4 | 1 |
| α-helix | 216-231 | 16 | |
| β-strand | 240-242 | 3 | 2 |
| α-helix | 247-249 | 3 | |
| β-strand | 251-252 | 2 | 2 |
| β-strand | 255-259 | 5 | 1 |
| α-helix | 267-283 | 17 | |
| β-strand | 292-295 | 4 | 1 |
| α-helix | 296-297 | 2 | |
| β-strand | 298-303 | 6 | 1 |
| β-strand | 308-313 | 6 | 3 |
| β-strand | 322-329 | 8 | 1 |
| β-strand | 331 | 1 | 4 |
| α-helix | 336-339 | 4 | |
| β-strand | 340 | 1 | 3 |
| β-strand | 343-345 | 3 | 3 |
| β-strand | 354-356 | 3 | 3 |
| β-strand | 359 | 1 | 4 |
| β-strand | 362-367 | 6 | 1 |
| β-strand | 374-379 | 6 | 3 |
| β-strand | 383-392 | 10 | 1 |
| α-helix | 393-402 | 10 | |
| β-strand | 412 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Egl nine homolog 1 | A | protein | 252 | HOMO SAPIENS | Q9GZT9 (AlphaFold model) |
>4BQY_1 EGL NINE HOMOLOG 1 (chains A) GSHMASPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGK FTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKING RTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFA DIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVEL NKPSDSVGKDVF
| ID | Name | Formula | Copies |
|---|---|---|---|
| FNT | (2S)-2-{[(1-chloro-4-hydroxyisoquinolin-3-yl)carbonyl]amino}propanoic acid | C13 H11 Cl N2 O4 | 1 |
| FE2 | FE (II) ion | Fe | 1 |
Selective small molecule probes for the hypoxia inducible factor (HIF) prolyl hydroxylases. Chowdhury, R., Candela-Lena, J.I., Chan, M.C. et al. ACS Chem Biol (2013) 8:1488-1496. DOI 10.1021/cb400088q · PubMed
Other PDB entries of the same protein (UniProt Q9GZT9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4BQY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.