Crystal structure of R-spondin 1 (Fu1Fu2) - Holmium soak. Determined by X-ray diffraction at 2.0 Å resolution. Released 19 Jun 2013.
Explore 4BSP in 3D Show helices and sheets RCSB PDB PDBe
4BSP contains 2 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 41 | 1 | 1 |
| β-strand | 44-48 | 5 | 1 |
| β-strand | 52-56 | 5 | 1 |
| β-strand | 61-67 | 7 | 1 |
| β-strand | 70-76 | 7 | 1 |
| α-helix | 79-80 | 2 | |
| β-strand | 83-87 | 5 | 1 |
| β-strand | 92-96 | 5 | 1 |
| β-strand | 102-107 | 6 | 2 |
| β-strand | 110-114 | 5 | 2 |
| α-helix | 115 | 1 | |
| β-strand | 119-121 | 3 | 3 |
| β-strand | 124-126 | 3 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| R-spondin-1 | A | protein | 126 | HOMO SAPIENS | Q2MKA7 (AlphaFold model) |
>4BSP_1 R-SPONDIN-1 (chains A) GSRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARN PDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAAA HHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| HO | Holmium atom | Ho | 2 |
Water and common crystallization additives (SO4) are not listed.
Structure of Stem Cell Growth Factor R-Spondin 1 in Complex with the Ectodomain of its Receptor Lgr5. Peng, W.C., De Lau, W., Forneris, F. et al. Cell Rep (2013) 3:1885. DOI 10.1016/J.CELREP.2013.06.009 · PubMed
Other PDB entries of the same protein (UniProt Q2MKA7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4BSP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.