4BSX: N terminal domain of TRIF

Crystal Structure of the N terminal domain of TRIF (TIR-domain- containing adapter-inducing interferon-beta). Determined by X-ray diffraction at 2.23 Å resolution. Released 11 Dec 2013.

Method: X-ray diffraction
Resolution: 2.23 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 4,776
Mol. weight: 69.15 kDa
Released: 11 Dec 2013

Explore 4BSX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BSX contains 40 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	8-16	9
α-helix	20-30	11
α-helix	40-50	11
α-helix	54-62	9
α-helix	68-76	9
α-helix	80-82	3
α-helix	88-91	4
α-helix	93-105	13
α-helix	111-127	17
α-helix	133-144	12

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	8-16	9
α-helix	20-30	11
α-helix	40-50	11
α-helix	54-62	9
α-helix	68-78	11
α-helix	80-82	3
α-helix	88-91	4
α-helix	93-105	13
α-helix	111-127	17
α-helix	133-144	12

Chain C: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	8-16	9
α-helix	20-30	11
α-helix	40-50	11
α-helix	54-63	10
α-helix	68-77	10
α-helix	80-82	3
α-helix	88-91	4
α-helix	93-105	13
α-helix	111-127	17
α-helix	133-144	12

Chain D: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	8-16	9
α-helix	20-30	11
α-helix	40-50	11
α-helix	54-62	9
α-helix	68-77	10
α-helix	80-82	3
α-helix	88-91	4
α-helix	93-105	13
α-helix	111-127	17
α-helix	133-144	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tir domain-containing adapter molecule 1	A, B, C, D	protein	156	HOMO SAPIENS	Q8IUC6 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4BSX_1 TIR DOMAIN-CONTAINING ADAPTER MOLECULE 1 (chains A, B, C, D)
SNAMACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEA
RISLEALKMDAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASMRDVA
YQEAVRTLSSRDDHRLGELQDEARNRCGWDIAGDPG

Primary citation

The Tlr Signalling Adaptor Trif/Ticam-1 Has an N-Terminal Helical Domain with Structural Similarity to Ifit Proteins. Ullah, M.O., Ve, T., Mangan, M. et al. Acta Crystallogr D Biol Crystallogr (2013) 69:2420. DOI 10.1107/S0907444913022385 · PubMed

Other PDB entries of the same protein (UniProt Q8IUC6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RC4 1.5 Å, Molecular mechanisms of viral and host-cell substrate recognition by HCV NS3/4A protease
5JEL 1.6 Å, Phosphorylated TRIF in complex with IRF-3
4C0M 2.8 Å, Crystal Structure of the N terminal domain of wild type TRIF (TIR- domain-containing…
9DK8 3.3 Å, TRIF TIR Filament Cryo-EM Structure
8RLM 3.5 Å, TRIF Oligomerisation
2M1X TICAM-1 TIR domain structure
2M63 The protease-resistant N-terminal domain of TIR-domain containing adaptor molecule-1,…

Browse structure collections

About this viewer

MolViewer shows 4BSX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.