Crystal structure of human SIRT3 in complex with the inhibitor ex-527 and 2'-O-acetyl-ADP-ribose. Determined by X-ray diffraction at 1.9 Å resolution. Released 17 Jul 2013.
Explore 4BVH in 3D Show helices and sheets RCSB PDB PDBe
4BVH contains 60 α-helices and 39 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 125-133 | 9 | |
| β-strand | 140-144 | 5 | 1 |
| α-helix | 146-148 | 3 | |
| α-helix | 150-152 | 3 | |
| α-helix | 164-166 | 3 | |
| α-helix | 176-180 | 5 | |
| β-strand | 181 | 1 | 2 |
| α-helix | 182-187 | 6 | |
| α-helix | 190-199 | 10 | |
| α-helix | 208-218 | 11 | |
| β-strand | 222-227 | 6 | 1 |
| α-helix | 233-236 | 4 | |
| α-helix | 241-243 | 3 | |
| β-strand | 244-246 | 3 | 1 |
| β-strand | 249-256 | 8 | 3 |
| β-strand | 262-264 | 3 | 3 |
| α-helix | 265-273 | 9 | |
| α-helix | 276-278 | 3 | |
| β-strand | 279 | 1 | 4 |
| α-helix | 285 | 1 | |
| β-strand | 286 | 1 | 4 |
| β-strand | 287-291 | 5 | 3 |
| β-strand | 294 | 1 | 2 |
| α-helix | 297-299 | 3 | |
| α-helix | 300-304 | 5 | |
| α-helix | 305-311 | 7 | |
| β-strand | 314-318 | 5 | 1 |
| α-helix | 327-330 | 4 | |
| β-strand | 340-344 | 5 | 1 |
| α-helix | 349-353 | 5 | |
| β-strand | 359-363 | 5 | 1 |
| α-helix | 366-377 | 12 | |
| α-helix | 380-391 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 125-133 | 9 | |
| β-strand | 140-144 | 5 | 5 |
| α-helix | 146-148 | 3 | |
| α-helix | 150-152 | 3 | |
| α-helix | 164-166 | 3 | |
| α-helix | 169-171 | 3 | |
| α-helix | 176-180 | 5 | |
| β-strand | 181 | 1 | 6 |
| α-helix | 182-187 | 6 | |
| α-helix | 190-199 | 10 | |
| α-helix | 208-218 | 11 | |
| β-strand | 222-227 | 6 | 5 |
| α-helix | 233-236 | 4 | |
| α-helix | 241-243 | 3 | |
| β-strand | 244-246 | 3 | 5 |
| β-strand | 249-256 | 8 | 7 |
| β-strand | 262-264 | 3 | 7 |
| α-helix | 266-272 | 7 | |
| α-helix | 276-278 | 3 | |
| β-strand | 279 | 1 | 8 |
| β-strand | 286 | 1 | 8 |
| β-strand | 287-291 | 5 | 7 |
| β-strand | 294 | 1 | 6 |
| α-helix | 297-299 | 3 | |
| α-helix | 300-304 | 5 | |
| α-helix | 305-311 | 7 | |
| β-strand | 314-318 | 5 | 5 |
| α-helix | 327-330 | 4 | |
| β-strand | 340-344 | 5 | 5 |
| α-helix | 349-353 | 5 | |
| β-strand | 359-363 | 5 | 5 |
| α-helix | 366-377 | 12 | |
| α-helix | 380-390 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 125-133 | 9 | |
| β-strand | 140-144 | 5 | 9 |
| α-helix | 146-148 | 3 | |
| α-helix | 150-152 | 3 | |
| α-helix | 164-167 | 4 | |
| α-helix | 176-180 | 5 | |
| β-strand | 181 | 1 | 10 |
| α-helix | 182-185 | 4 | |
| α-helix | 190-199 | 10 | |
| α-helix | 208-218 | 11 | |
| β-strand | 222-227 | 6 | 9 |
| α-helix | 233-236 | 4 | |
| α-helix | 241-243 | 3 | |
| β-strand | 244-246 | 3 | 9 |
| β-strand | 249-256 | 8 | 11 |
| β-strand | 262-264 | 3 | 11 |
| α-helix | 265-268 | 4 | |
| α-helix | 269-273 | 5 | |
| β-strand | 279 | 1 | 12 |
| α-helix | 285 | 1 | |
| β-strand | 286 | 1 | 12 |
| β-strand | 287-291 | 5 | 11 |
| β-strand | 294 | 1 | 10 |
| α-helix | 297-299 | 3 | |
| α-helix | 300-304 | 5 | |
| α-helix | 305-311 | 7 | |
| β-strand | 314-318 | 5 | 9 |
| α-helix | 328-332 | 5 | |
| β-strand | 340-344 | 5 | 9 |
| α-helix | 349-353 | 5 | |
| β-strand | 359-363 | 5 | 9 |
| α-helix | 366-377 | 12 | |
| α-helix | 380-391 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| NAD-dependent protein deacetylase sirtuin-3, mitochondrial | A, B, C | protein | 284 | HOMO SAPIENS | Q9NTG7 (AlphaFold model) |
>4BVH_1 NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-3, MITOCHONDRIAL (chains A, B, C) GSSDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPY PEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLER VSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFG EPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHP RSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
| ID | Name | Formula | Copies |
|---|---|---|---|
| AR6 | [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-dihydroxy-oxolan-2-yl]methyl[hydroxy-[… | C15 H23 N5 O14 P2 | 1 |
| ZN | Zinc ion | Zn | 3 |
| OAD | 2'-O-acetyl adenosine-5-diphosphoribose | C17 H25 N5 O15 P2 | 2 |
| OCZ | (1S)-6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1- carboxamide | C13 H13 Cl N2 O | 3 |
Water and common crystallization additives (GOL, EDO, CL, NA) are not listed.
Ex-527 Inhibits Sirtuins by Exploiting Their Unique Nad+-Dependent Deacetylation Mechanism. Gertz, M., Fischer, F., Nguyen, G.T.T. et al. Proc Natl Acad Sci U S A (2013) 110:E2772. DOI 10.1073/PNAS.1303628110 · PubMed
Other PDB entries of the same protein (UniProt Q9NTG7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4BVH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.