Crystal structure of human Sirt3 in complex with an acetylated HIV1 Tat-46-54 substrate peptide. Determined by X-ray diffraction at 1.65 Å resolution. Released 10 May 2023.
Explore 8CCW in 3D Show helices and sheets RCSB PDB PDBe
8CCW contains 23 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 122-124 | 3 | |
| α-helix | 125-133 | 9 | |
| β-strand | 140-144 | 5 | 1 |
| α-helix | 146-148 | 3 | |
| α-helix | 150-152 | 3 | |
| α-helix | 154-156 | 3 | |
| α-helix | 163-169 | 7 | |
| α-helix | 176-180 | 5 | |
| β-strand | 181 | 1 | 2 |
| α-helix | 182-187 | 6 | |
| α-helix | 190-199 | 10 | |
| α-helix | 208-218 | 11 | |
| β-strand | 222-227 | 6 | 1 |
| α-helix | 233-236 | 4 | |
| α-helix | 241-243 | 3 | |
| β-strand | 244-246 | 3 | 1 |
| β-strand | 249-256 | 8 | 3 |
| β-strand | 262-264 | 3 | 3 |
| α-helix | 265-268 | 4 | |
| α-helix | 269-273 | 5 | |
| β-strand | 279 | 1 | 4 |
| α-helix | 285 | 1 | |
| β-strand | 286 | 1 | 4 |
| β-strand | 287-291 | 5 | 3 |
| α-helix | 292-293 | 2 | |
| β-strand | 294 | 1 | 2 |
| β-strand | 297 | 1 | 5 |
| α-helix | 298-299 | 2 | |
| α-helix | 300-304 | 5 | |
| α-helix | 305-311 | 7 | |
| β-strand | 314-318 | 5 | 1 |
| β-strand | 324-325 | 2 | 6 |
| α-helix | 328-332 | 5 | |
| β-strand | 340-344 | 5 | 1 |
| α-helix | 350-353 | 4 | |
| β-strand | 359-363 | 5 | 1 |
| α-helix | 366-377 | 12 | |
| α-helix | 380-393 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 49 | 1 | 5 |
| β-strand | 51-52 | 2 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| NAD-dependent protein deacetylase sirtuin-3, mitochondrial | A | protein | 282 | Homo sapiens | Q9NTG7 (AlphaFold model) |
| Protein Tat | B | protein | 9 | Human immunodeficiency virus 1 | P12506 |
>8CCW_1 NAD-dependent protein deacetylase sirtuin-3, mitochondrial (chains A) SDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPE AIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVS GIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEP LPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRS RDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
>8CCW_2 Protein Tat (chains B) SYGRKKRRQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Molecular Mechanism of Sirtuin 1 Inhibition by Human Immunodeficiency Virus 1 Tat Protein. Adolph, R.S., Beck, E., Schweimer, K. et al. Life (Basel) (2023) 13. DOI 10.3390/life13040949 · PubMed
Other PDB entries of the same protein (UniProt Q9NTG7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8CCW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.