4BVN: Beta-1 adrenergic receptor

Ultra-thermostable beta1-adrenoceptor with cyanopindolol bound. Determined by X-ray diffraction at 2.1 Å resolution. Released 2 Apr 2014.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: MELEAGRIS GALLOPAVO
Chains: 1
Atoms: 2,506
Mol. weight: 38.91 kDa
Ligands: P32, OLC, MHA
Released: 2 Apr 2014

Explore 4BVN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BVN contains 16 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	37-68	32
α-helix	70-72	3
α-helix	75-89	15
α-helix	90-94	5
α-helix	95-104	10
α-helix	110-144	35
α-helix	146-152	7
α-helix	155-178	24
α-helix	187-194	8
α-helix	205-212	8
α-helix	213-217	5
α-helix	218-239	22
α-helix	279-315	37
α-helix	317-319	3
α-helix	322-343	22
α-helix	347-356	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-1 adrenergic receptor	A	protein	315	MELEAGRIS GALLOPAVO	P07700 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4BVN_1 BETA-1 ADRENERGIC RECEPTOR (chains A)
MGAELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVV
GLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASVETLCVIAIDRYLAITSPFRYQ
SLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCDFVTNRAYAIA
SSIISFYIPLLIMIFVALRVYREAKEQIRKIDRASKRKTSRVMLMREHKALKTLGIIMGV
FTLCWLPFFLVNIVNVFNRDLVPKWLFVAFNWLGYANSAMNPIILCRSPDFRKAFKRLLA
FPRKADRRLHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
P32	Cyanopindolol	C16 H21 N3 O2	1
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	7
MHA	(carbamoylmethyl-carboxymethyl-amino)-acetic acid	C6 H10 N2 O5	1

Water and common crystallization additives (NA) are not listed.

Primary citation

The 2.1 A Resolution Structure of Cyanopindolol-Bound Beta1- Adrenoceptor Identifies an Intramembrane Na+ Ion that Stabilises the Ligand-Free Receptor. Miller-Gallacher, J.L., Nehme, R., Warne, T. et al. PLoS One (2014) 9:92727. DOI 10.1371/JOURNAL.PONE.0092727 · PubMed

Other PDB entries of the same protein (UniProt P07700 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4AMJ 2.3 Å, Turkey beta1 adrenergic receptor with stabilising mutations and bound biased agonist…
5A8E 2.4 Å, thermostabilised beta1-adrenoceptor with rationally designed inverse agonist…
2Y00 2.5 Å, Turkey BETA1 adrenergic receptor with stabilising mutations and bound partial agonist…
6H7N 2.5 Å, Activated turkey BETA1 adrenoceptor with bound partial agonist xamoterol and nanobody…
8DCS 2.5 Å, Cryo-EM structure of cyanopindolol-bound beta1-adrenergic receptor in complex with…
2Y01 2.6 Å, Turkey BETA1 adrenergic receptor with stabilising mutations and bound partial agonist…
2Y02 2.6 Å, Turkey BETA1 adrenergic receptor with stabilising mutations and bound agonist carmoterol
7JJO 2.6 Å, Structural Basis of the Activation of Heterotrimeric Gs-protein by Isoproterenol-bound…
8DCR 2.6 Å, Cryo-EM structure of dobutamine-bound beta1-adrenergic receptor in complex with…
2VT4 2.7 Å, Turkey BETA1 adrenergic receptor with stabilising mutations and bound cyanopindolol
3ZPR 2.7 Å, Thermostabilised turkey beta1 adrenergic receptor with 4-methyl-2-(piperazin-1-yl)…
6H7L 2.7 Å, Activated turkey BETA1 adrenoceptor with bound partial agonist dobutamine and nanobody…

Browse structure collections

About this viewer

MolViewer shows 4BVN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.