4BZI: COPII coat assembled on membranes

The structure of the COPII coat assembled on membranes. Determined by electron microscopy at 23.0 Å resolution. Released 18 Sept 2013.

Method: Electron microscopy
Resolution: 23.0 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 12
Atoms: 39,154
Mol. weight: 945.06 kDa
Ligands: MG, GNP, ZN
Released: 18 Sept 2013

Explore 4BZI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BZI contains 242 α-helices and 267 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 32 helices, 42 β-strands

Element	Residues	Length	Sheet
α-helix	3-10	8
β-strand	12-14	3	1
β-strand	16	1	2
β-strand	18-20	3	3
α-helix	23-28	6
α-helix	32	1
β-strand	33-37	5	1
β-strand	48-49	2	3
β-strand	55	1	4
β-strand	64	1	4
α-helix	69-70	2
β-strand	71-72	2	5
β-strand	77-79	3	5
β-strand	86-88	3	5
α-helix	89-90	2
α-helix	103-106	4
β-strand	109-117	9	3
α-helix	118	1
β-strand	123-129	7	6
α-helix	134-148	15
β-strand	156-162	7	6
β-strand	165-170	6	6
β-strand	178-183	6	6
α-helix	190-198	9
α-helix	224-227	4
β-strand	229-230	2	6
α-helix	231-244	14
β-strand	256	1	7
α-helix	262-276	15
β-strand	282-288	7	6
β-strand	303	1	7
α-helix	307-309	3
α-helix	311-315	5
α-helix	322-339	18
β-strand	341-348	8	6
α-helix	355-358	4
α-helix	360-363	4
β-strand	369-372	4	6
α-helix	378-386	9
β-strand	390	1	8
β-strand	396	1	8
β-strand	399-408	10	3
β-strand	412-418	7	1
β-strand	422-423	2	3
β-strand	432	1	1
β-strand	439	1	1
β-strand	444-450	7	3
β-strand	456-462	7	1
β-strand	484-495	12	3
β-strand	499-512	14	3
α-helix	517-521	5
β-strand	523	1	2
α-helix	525-540	16
α-helix	545-563	19
β-strand	565-567	3	9
β-strand	570-575	6	9
α-helix	583-591	9
α-helix	603-613	11
α-helix	618-625	8
β-strand	628-632	5	10
β-strand	639-640	2	10
β-strand	644	1	11
β-strand	653-657	5	10
β-strand	661-666	6	10
α-helix	668-676	9
α-helix	678-680	3
α-helix	686-702	17
α-helix	708-709	2
β-strand	710-715	6	10
α-helix	719-721	3
α-helix	722-725	4
β-strand	729	1	11
α-helix	749-751	3
α-helix	752-763	12

Chains B, J and K: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	25-29	5	12
α-helix	36-45	10
α-helix	52-54	3
β-strand	58-62	5	12
β-strand	69-73	5	12
α-helix	78-87	10
β-strand	93-99	7	12
α-helix	103-105	3
α-helix	106-117	12
β-strand	127-132	6	12
α-helix	142-149	8
α-helix	164-165	2
β-strand	166-171	6	12
β-strand	172	1	13
β-strand	177	1	13
α-helix	179-186	8

Chains D and G: 33 helices, 42 β-strands

Element	Residues	Length	Sheet
α-helix	3-10	8
β-strand	12-14	3	14
β-strand	16	1	15
β-strand	18-20	3	16
α-helix	23-28	6
α-helix	32	1
β-strand	33-37	5	14
β-strand	48-49	2	16
β-strand	55	1	17
β-strand	64	1	17
α-helix	69-70	2
β-strand	71-72	2	18
β-strand	77-79	3	18
β-strand	86-88	3	18
α-helix	89-90	2
α-helix	103-106	4
β-strand	109-117	9	16
α-helix	118	1
β-strand	123-129	7	19
α-helix	134-148	15
β-strand	156-162	7	19
β-strand	165-170	6	19
β-strand	178-183	6	19
α-helix	190-198	9
α-helix	224-227	4
β-strand	229-230	2	19
α-helix	231-244	14
β-strand	256	1	20
α-helix	262-276	15
β-strand	282-288	7	19
β-strand	303	1	20
α-helix	307-309	3
α-helix	311-315	5
α-helix	322-339	18
β-strand	341-348	8	19
α-helix	355-358	4
α-helix	360-363	4
β-strand	369-372	4	19
α-helix	378-386	9
β-strand	390	1	21
β-strand	396	1	21
β-strand	399-408	10	16
β-strand	412-418	7	14
β-strand	422-423	2	16
β-strand	432	1	14
β-strand	439	1	14
β-strand	444-450	7	16
β-strand	456-462	7	14
β-strand	484-495	12	16
β-strand	499-512	14	16
α-helix	517-521	5
β-strand	523	1	15
α-helix	525-540	16
α-helix	545-563	19
β-strand	565-567	3	22
β-strand	570-575	6	22
α-helix	583-591	9
α-helix	603-613	11
α-helix	618-625	8
β-strand	628-632	5	23
β-strand	639-640	2	23
β-strand	644	1	24
α-helix	645-647	3
β-strand	653-657	5	23
β-strand	661-666	6	23
α-helix	668-676	9
α-helix	678-680	3
α-helix	686-702	17
α-helix	708-709	2
β-strand	710-715	6	23
α-helix	719-721	3
α-helix	722-725	4
β-strand	729	1	24
α-helix	749-751	3
α-helix	752-763	12

Chains E, L and M: 39 helices, 39 β-strands

Element	Residues	Length	Sheet
α-helix	135-138	4
β-strand	140-142	3	25
α-helix	153-155	3
α-helix	157-160	4
α-helix	165-167	3
β-strand	182-184	3	26
β-strand	186	1	27
β-strand	189-190	2	28
β-strand	192	1	29
α-helix	193-199	7
β-strand	204-207	4	26
α-helix	219-221	3
β-strand	222-223	2	30
β-strand	230	1	31
α-helix	236	1
β-strand	237	1	31
α-helix	238	1
β-strand	243-245	3	32
β-strand	250-252	3	32
β-strand	259-261	3	32
α-helix	262-263	2
α-helix	264-266	3
α-helix	274-279	6
α-helix	281-284	4
β-strand	287-291	5	30
α-helix	294-296	3
α-helix	302-304	3
β-strand	305	1	33
β-strand	306-311	6	6
α-helix	314-318	5
α-helix	321-331	11
β-strand	344-345	2	33
β-strand	347-350	4	6
β-strand	354-358	5	6
β-strand	374-378	5	6
β-strand	394-395	2	33
α-helix	400-413	14
α-helix	424-435	12
β-strand	440-446	7	6
α-helix	471	1
α-helix	472-476	5
α-helix	482-493	12
β-strand	495-503	9	6
α-helix	509-517	9
β-strand	523-527	5	6
α-helix	534-549	16
β-strand	553-562	10	30
β-strand	566-572	7	26
β-strand	576	1	30
β-strand	582-588	7	30
β-strand	594-600	7	26
β-strand	603	1	29
β-strand	608-619	12	30
β-strand	623-634	12	30
β-strand	635-636	2	28
α-helix	639-644	6
β-strand	646	1	27
α-helix	648-665	18
α-helix	669-685	17
α-helix	686-690	5
β-strand	702-704	3	25
α-helix	705-707	3
α-helix	710-718	9
α-helix	730-742	13
α-helix	745-752	8
β-strand	755-758	4	34
α-helix	780-782	3
α-helix	784-786	3
β-strand	787	1	34
β-strand	799-803	5	34
β-strand	807-812	6	34
α-helix	819-821	3
α-helix	849-858	10
α-helix	869	1
β-strand	870-874	5	34
α-helix	890-900	11
α-helix	910-912	3
α-helix	913-924	12

Chains F, N and O: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	64-72	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SEC23P	A, D, G	protein	768	SACCHAROMYCES CEREVISIAE	P15303 (AlphaFold model)
SAR1P	B, J, K	protein	190	SACCHAROMYCES CEREVISIAE	P20606 (AlphaFold model)
SEC24P	E, L, M	protein	926	SACCHAROMYCES CEREVISIAE	P40482 (AlphaFold model)
SEC24P	F, N, O	protein	926	SACCHAROMYCES CEREVISIAE	P40482 (AlphaFold model)

Sequence of entity 1 (A, D, G), FASTA

>4BZI_1 SEC23P (chains A, D, G)
MDFETNEDINGVRFTWNVFPSTRSDANSNVVPVGCLYTPLKEYDELNVAPYNPVVCSGPH
CKSILNPYCVIDPRNSSWSCPICNSRNHLPPQYTNLSQENMPLELQSTTIEYITNKPVTV
PPIFFFVVDLTSETENLDSLKESIITSLSLLPPNALIGLITYGNVVQLHDLSSETIDRCN
VFRGDREYQLEALTEMLTGQKPTGPGGAASHLPNAMNKVTPFSLNRFFLPLEQVEFKLNQ
LLENLSPDQWSVPAGHRPLRATGSALNIASLLLQGCYKNIPARIILFASGPGTVAPGLIV
NSELKDPLRSHHDIDSDHAQHYKKACKFYNQIAQRVAANGHTVDIFAGCYDQIGMSEMKQ
LTDSTGGVLLLTDAFSTAIFKQSYLRLFAKDEEGYLKMAFNGNMAVKTSKDLKVQGLIGH
ASAVKKTDANNISESEIGIGATSTWKMASLSPYHSYAIFFEIANTAANSNPMMSAPGSAD
RPHLAYTQFITTYQHSSGTNRIRVTTVANQLLPFGTPAIAASFDQEAAAVLMARIAVHKA
ETDDGADVIRWLDRTLIKLCQKYADYNKDDPQSFRLAPNFSLYPQFTYYLRRSQFLSVFN
NSPDETAFYRHIFTREDTTNSLIMIQPTLTSFSMEDDPQPVLLDSISVKPNTILLLDTFF
FILIYHGEQIAQWRKAGYQDDPQYADFKALLEEPKLEAAELLVDRFPLPRFIDTEAGGSQ
ARFLLSKLNPSDNYQDMARGGSTIVLTDDVSLQNFMTHLQQVAVSGQA

Sequence of entity 2 (B, J, K), FASTA

>4BZI_2 SAR1P (chains B, J, K)
MAGWDIFGWFRDVLASLGLWNKHGKLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPTSE
ELAIGNIKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIA
ELKDVPFVILGNKIDAPNAVSEAELRSALGLLNTTGSQRIEGQRPVEVFMCSVVMRNGYL
EAFQWLSQYI

Sequence of entity 3 (E, L, M), FASTA

>4BZI_3 SEC24P (chains E, L, M)
MSHHKKRVYPQAQLQYGQNATPLQQPAQFMPPQDPAAAGMSYGQMGMPPQGAVPSMGQQQ
FLTPAQEQLHQQIDQATTSMNDMHLHNVPLVDPNAYMQPQVPVQMGTPLQQQQQPMAAPA
YGQPSAAMGQNMRPMNQLYPIDLLTELPPPITDLTLPPPPLVIPPERMLVPSELSNASPD
YIRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDGLIVRCRRCRSYMNP
FVTFIEQGRRWRCNFCRLANDVPMQMDQSDPNDPKSRYDRNEIKCAVMEYMAPKEYTLRQ
PPPATYCFLIDVSQSSIKSGLLATTINTLLQNLDSIPNHDERTRISILCVDNAIHYFKIP
LDSENNEESADQINMMDIADLEEPFLPRPNSMVVSLKACRQNIETLLTKIPQIFQSNLIT
NFALGPALKSAYHLIGGVGGKIIVVSGTLPNLGIGKLQRRNESGVVNTSKETAQLLSCQD
SFYKNFTIDCSKVQITVDLFLASEDYMDVASLSNLSRFTAGQTHFYPGFSGKNPNDIVKF
STEFAKHISMDFCMETVMRARGSTGLRMSRFYGHFFNRSSDLCAFSTMPRDQSYLFEVNV
DESIMADYCYVQVAVLLSLNNSQRRIRIITLAMPTTESLAEVYASADQLAIASFYNSKAV
EKALNSSLDDARVLINKSVQDILATYKKEIVVSNTAGGAPLRLCANLRMFPLLMHSLTKH
MAFRSGIVPSDHRASALNNLESLPLKYLIKNIYPDVYSLHDMADEAGLPVQTEDGEATGT
IVLPQPINATSSLFERYGLYLIDNGNELFLWMGGDAVPALVFDVFGTQDIFDIPIGKQEI
PVVENSEFNQRVRNIINQLRNHDDVITYQSLYIVRGASLSEPVNHASAREVATLRLWASS
TLVEDKILNNESYREFLQIMKARISK

Sequence of entity 4 (F, N, O), FASTA

>4BZI_4 SEC24P (chains F, N, O)
MSHHKKRVYPQAQLQYGQNATPLQQPAQFMPPQDPAAAGMSYGQMGMPPQGAVPSMGQQQ
FLTPAQEQLHQQIDQATTSMNDMHLHNVPLVDPNAYMQPQVPVQMGTPLQQQQQPMAAPA
YGQPSAAMGQNMRPMNQLYPIDLLTELPPPITDLTLPPPPLVIPPERMLVPSELSNASPD
YIRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDGLIVRCRRCRSYMNP
FVTFIEQGRRWRCNFCRLANDVPMQMDQSDPNDPKSRYDRNEIKCAVMEYMAPKEYTLRQ
PPPATYCFLIDVSQSSIKSGLLATTINTLLQNLDSIPNHDERTRISILCVDNAIHYFKIP
LDSENNEESADQINMMDIADLEEPFLPRPNSMVVSLKACRQNIETLLAKIPQIFQSNLIT
NFALGPALKSAYHLIGGVGGKIIVVSGTLPNLGIGKLQRRNESGVVNTSKETAQLLSCQD
SFYKNFTIDCSKVQITVDLFLASEDYMDVASLSNLSRFTAGQTHFYPGFSGKNPNDIVKF
STEFAKHISMDFCMETVMRARGSTGLRMSRFYGHFFNRSSDLCAFSTMPRDQSYLFEVNV
DESIMADYCYVQVAVLLSLNNSQRRIRIITLAMPTTESLAEVYASADQLAIASFYNSKAV
EKALNSSLDDARVLINKSVQDILATYKKEIVVSNTAGGAPLRLCANLRMFPLLMHSLTKH
MAFRSGIVPSDHRASALNNLESLPLKYLIKNIYPDVYSLHDMADEAGLPVQTEDGEATGT
IVLPQPINATSSLFERYGLYLIDNGNELFLWMGGDAVPALVFDVFGTQDIFDIPIGKQEI
PVVENSEFNQRVRNIINQLRNHDDAITYQSLYIVRGASLSEPVNHASAREVATLRLWASS
TLVEDKILNNESYREFLQIMKARISK

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	3
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	3
ZN	Zinc ion	Zn	6

Primary citation

The Structure of the Copii Transport-Vesicle Coat Assembled on Membranes. Zanetti, G., Prinz, S., Daum, S. et al. Elife (2013) 2:00951. DOI 10.7554/ELIFE.00951 · PubMed

Other PDB entries of the same protein (UniProt P15303 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1M2O 2.5 Å, Crystal Structure of the Sec23-Sar1 complex
2QTV 2.5 Å, Structure of Sec23-Sar1 complexed with the active fragment of Sec31
1M2V 2.75 Å, Crystal Structure of the yeast Sec23/24 heterodimer
8BSH 3.8 Å, COPII inner coat
6ZGA 4.6 Å, COPII on membranes, inner coat
6GNI 4.9 Å, Cryo-tomography and subtomogram averaging of Sar1-Sec23-Sec24 - fitted model.

Browse structure collections

About this viewer

MolViewer shows 4BZI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.