4C5I: MBTD1 YY1 complex

Crystal structure of MBTD1 YY1 complex. Determined by X-ray diffraction at 2.59 Å resolution. Released 13 Nov 2013.

Method: X-ray diffraction
Resolution: 2.59 Å
Organism: HOMO SAPIENS
Chains: 3
Atoms: 6,904
Mol. weight: 103.18 kDa
Released: 13 Nov 2013

Explore 4C5I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4C5I contains 41 α-helices and 58 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	143-150	8
β-strand	154	1	1
α-helix	155-156	2
α-helix	157-159	3
β-strand	177-181	5	2
β-strand	192-201	10	2
β-strand	204-209	6	2
β-strand	220-223	4	2
β-strand	230	1	2
α-helix	234-237	4
β-strand	242	1	2
α-helix	246-248	3
α-helix	255-263	9
β-strand	267	1	3
α-helix	269-270	2
α-helix	273-280	8
β-strand	289-295	7	4
β-strand	298-311	14	4
β-strand	314-319	6	4
β-strand	328-332	5	4
β-strand	338-339	2	4
α-helix	343-347	5
β-strand	350-351	2	4
α-helix	352-354	3
β-strand	364-365	2	4
α-helix	368-370	3
α-helix	372-376	5
β-strand	389-394	6	5
β-strand	397-409	13	5
α-helix	411-413	3
β-strand	414-419	6	5
β-strand	431-434	4	5
β-strand	440-441	2	5
α-helix	445-448	4
β-strand	453-454	2	5
α-helix	455-456	2
α-helix	466-472	7
β-strand	477	1	5
α-helix	478-479	2
α-helix	480-483	4
β-strand	497-501	5	1
β-strand	509-518	10	1
β-strand	521-526	6	1
α-helix	531-533	3
β-strand	535-538	4	1
β-strand	544-545	2	1
α-helix	549-553	5
β-strand	558	1	1
α-helix	559-561	3

Chain B: 20 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	143-150	8
β-strand	154	1	6
α-helix	157-159	3
β-strand	177-181	5	7
β-strand	192-201	10	7
β-strand	204-209	6	7
β-strand	220-223	4	7
β-strand	230-231	2	7
α-helix	234-238	5
α-helix	240-241	2
β-strand	242	1	7
α-helix	246-248	3
α-helix	255-263	9
β-strand	268	1	7
α-helix	273-280	8
β-strand	289-294	6	8
β-strand	301-311	11	8
β-strand	314-319	6	8
β-strand	328-332	5	8
β-strand	338-339	2	8
α-helix	343-347	5
β-strand	350-351	2	8
β-strand	364-365	2	8
α-helix	366-367	2
α-helix	368-370	3
α-helix	372-373	2
β-strand	389-394	6	9
β-strand	397-409	13	9
β-strand	414-419	6	9
α-helix	430	1
β-strand	431-434	4	9
β-strand	440-441	2	9
α-helix	445-448	4
β-strand	453-454	2	9
α-helix	464	1
α-helix	466-473	8
β-strand	477	1	9
α-helix	478-479	2
α-helix	480-483	4
β-strand	497-501	5	6
β-strand	509-518	10	6
β-strand	521-526	6	6
α-helix	531-533	3
β-strand	535-538	4	6
β-strand	544-545	2	6
α-helix	549-553	5
β-strand	558	1	6
α-helix	559-561	3

Chain C: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	207-211	5	3
β-strand	220-224	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mbt domain-containing protein 1	A, B	protein	440	HOMO SAPIENS	Q05BQ5 (AlphaFold model)
Transcriptional repressor protein YY1	C	protein	30	HOMO SAPIENS	P25490 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4C5I_1 MBT DOMAIN-CONTAINING PROTEIN 1 (chains A, B)
GAMAKTKAAVSMEGFSWGNYINSNSFIAAPVTCFKHAPMGTCWGDISENVRVEVPNTDCS
LPTKVFWIAGIVKLAGYNALLRYEGFENDSGLDFWCNICGSDIHPVGWCAASGKPLVPPR
TIQHKYTNWKAFLVKRLTGAKTLPPDFSQKVSESMQYPFKPCMRVEVVDKRHLCRTRVAV
VESVIGGRLRLVYEESEDRTDDFWCHMHSPLIHHIGWSRSIGHRFKRSDITKKQDGHFDT
PPHLFAKVKEVDQSGEWFKEGMKLEAIDPLNLSTICVATIRKVLADGFLMIGIDGSEAAD
GSDWFCYHATSPSIFPVGFCEINMIELTPPRGYTKLPFKWFDYLRETGSIAAPVKLFNKD
VPNHGFRVGMKLEAVDLMEPRLICVATVTRIIHRLLRIHFDGWEEEYDQWVDCESPDLYP
VGWCQLTGYQLQPPASQSSR

Sequence of entity 2 (C), FASTA

>4C5I_2 TRANSCRIPTIONAL REPRESSOR PROTEIN YY1 (chains C)
DPGNKKWEQKQVQIKTLEGEFSVTMWSSDE

Primary citation

Structural Basis for Targeting the Chromatin Repressor Sfmbt to Polycomb Response Elements. Alfieri, C., Gambetta, M.C., Matos, R. et al. Genes Dev (2013) 27:2367. DOI 10.1101/GAD.226621.113 · PubMed

Other PDB entries of the same protein (UniProt Q05BQ5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6NFX 1.95 Å, MBTD1 MBT repeats
3FEO 2.5 Å, The crystal structure of MBTD1

Browse structure collections

About this viewer

MolViewer shows 4C5I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.