Xenopus ZNRF3 ectodomain crystal form I. Determined by X-ray diffraction at 2.4 Å resolution. Released 20 Nov 2013.
Explore 4C8T in 3D Show helices and sheets RCSB PDB PDBe
4C8T contains 12 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 31-41 | 11 | 1 |
| β-strand | 47-58 | 12 | 1 |
| β-strand | 62 | 1 | 2 |
| β-strand | 67-74 | 8 | 1 |
| α-helix | 76-79 | 4 | |
| β-strand | 93-98 | 6 | 1 |
| α-helix | 99-101 | 3 | |
| α-helix | 102-104 | 3 | |
| α-helix | 112-121 | 10 | |
| β-strand | 124-130 | 7 | 1 |
| α-helix | 136-141 | 6 | |
| α-helix | 147-148 | 2 | |
| β-strand | 149 | 1 | 2 |
| β-strand | 153-156 | 4 | 1 |
| α-helix | 158-170 | 13 | |
| β-strand | 174-179 | 6 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 31-41 | 11 | 3 |
| β-strand | 47-58 | 12 | 3 |
| β-strand | 62-63 | 2 | 4 |
| β-strand | 67-74 | 8 | 3 |
| α-helix | 76-79 | 4 | |
| β-strand | 93-98 | 6 | 3 |
| α-helix | 112-121 | 10 | |
| β-strand | 124-130 | 7 | 3 |
| α-helix | 137-141 | 5 | |
| α-helix | 147-148 | 2 | |
| β-strand | 149-152 | 4 | 4 |
| β-strand | 153-156 | 4 | 3 |
| α-helix | 158-168 | 11 | |
| β-strand | 174-179 | 6 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase ZNRF3 | A, B | protein | 182 | XENOPUS (SILURANA) TROPICALIS | Q08D68 (AlphaFold model) |
>4C8T_1 E3 UBIQUITIN-PROTEIN LIGASE ZNRF3 (chains A, B) ETGESLAKETAFVEVVLFESSPNGDYKTHTTELQGRFSRAGATISAEGEIVQMHPLGLCN NNDEEDLYEYGWVGVVKLEQPEMDPKPCLTVLGKAKRAVQRGATAVIFDVSDNPDAVEQL NQGLEDPLKRPVVYMKGMDAIKLMNIVNKQKGARARIQHRPPRQPTEYFDGTHHHHHHHH HH
Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin. Zebisch, M., Xu, Y., Krastev, C. et al. Nat Commun (2013) 4:2787. DOI 10.1038/NCOMMS3787 · PubMed
Other PDB entries of the same protein (UniProt Q08D68 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4C8T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.