Xenopus ZNRF3 ectodomain in complex with Xenopus RSPO2 Fu1-Fu2 crystal form I. Determined by X-ray diffraction at 2.1 Å resolution. Released 20 Nov 2013.
Explore 4C9R in 3D Show helices and sheets RCSB PDB PDBe
4C9R contains 20 α-helices and 40 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 25-30 | 6 | |
| β-strand | 31-41 | 11 | 1 |
| β-strand | 47-58 | 12 | 1 |
| β-strand | 67-73 | 7 | 1 |
| α-helix | 76-78 | 3 | |
| α-helix | 89-90 | 2 | |
| β-strand | 93-98 | 6 | 1 |
| α-helix | 102-104 | 3 | |
| α-helix | 112-121 | 10 | |
| β-strand | 124-130 | 7 | 1 |
| α-helix | 136-142 | 7 | |
| α-helix | 147-149 | 3 | |
| β-strand | 153-156 | 4 | 1 |
| α-helix | 158-170 | 13 | |
| β-strand | 175-179 | 5 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 43-47 | 5 | 2 |
| β-strand | 51-55 | 5 | 2 |
| β-strand | 60-66 | 7 | 2 |
| β-strand | 69-75 | 7 | 2 |
| α-helix | 78-79 | 2 | |
| β-strand | 82-86 | 5 | 2 |
| β-strand | 91-95 | 5 | 2 |
| β-strand | 101-106 | 6 | 3 |
| β-strand | 109-113 | 5 | 3 |
| α-helix | 117 | 1 | |
| β-strand | 118-120 | 3 | 4 |
| β-strand | 123-125 | 3 | 4 |
| α-helix | 128-129 | 2 | |
| β-strand | 133-134 | 2 | 5 |
| β-strand | 140 | 1 | 4 |
| β-strand | 141-142 | 2 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 28-30 | 3 | |
| β-strand | 31-41 | 11 | 6 |
| β-strand | 47-58 | 12 | 6 |
| β-strand | 67-73 | 7 | 6 |
| α-helix | 76-78 | 3 | |
| β-strand | 93-98 | 6 | 6 |
| α-helix | 99-101 | 3 | |
| α-helix | 102-104 | 3 | |
| α-helix | 112-121 | 10 | |
| β-strand | 124-130 | 7 | 6 |
| α-helix | 136-141 | 6 | |
| α-helix | 147-149 | 3 | |
| β-strand | 153-156 | 4 | 6 |
| α-helix | 158-170 | 13 | |
| β-strand | 175-179 | 5 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 43-47 | 5 | 7 |
| β-strand | 51-55 | 5 | 7 |
| β-strand | 60-66 | 7 | 7 |
| β-strand | 69-75 | 7 | 7 |
| α-helix | 78-79 | 2 | |
| β-strand | 82-86 | 5 | 7 |
| β-strand | 91-95 | 5 | 7 |
| β-strand | 101-104 | 4 | 8 |
| β-strand | 110-113 | 4 | 8 |
| β-strand | 118-120 | 3 | 9 |
| β-strand | 123-125 | 3 | 9 |
| β-strand | 132-134 | 3 | 10 |
| β-strand | 140 | 1 | 9 |
| β-strand | 141-143 | 3 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase ZNRF3 | A, C | protein | 182 | XENOPUS (SILURANA) TROPICALIS | Q08D68 (AlphaFold model) |
| R-spondin-2 | B, D | protein | 121 | XENOPUS (SILURANA) TROPICALIS | Q5M7L6 (AlphaFold model) |
>4C9R_1 E3 UBIQUITIN-PROTEIN LIGASE ZNRF3 (chains A, C) ETGESLAKETAFVEVVLFESSPNGDYKTHTTELQGRFSRAGATISAEGEIVQMHPLGLCN NNDEEDLYEYGWVGVVKLEQPEMDPKPCLTVLGKAKRAVQRGATAVIFDVSDNPDAVEQL NQGLEDPLKRPVVYMKGMDAIKLMNIVNKQKGARARIQHRPPRQPTEYFDGTHHHHHHHH HH
>4C9R_2 R-SPONDIN-2 (chains B, D) ETGGTNPICKGCLSCSKDNGCLRCQPKLFFYLRREGMRQYGECLQSCPPGYYGVRGPDMN RCSRCRIENCDSCFSRDFCIKCKSGFYSHKGQCFEECPEGFAPLDDTMVCVDGTKHHHHH H
Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin. Zebisch, M., Xu, Y., Krastev, C. et al. Nat Commun (2013) 4:2787. DOI 10.1038/NCOMMS3787 · PubMed
Other PDB entries of the same protein (UniProt Q08D68 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4C9R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.