4CC4: Inlc protein

Complex of InlC of Listeria monocytogenes and human Tuba C-terminal SH3 domain. Determined by X-ray diffraction at 2.6 Å resolution. Released 30 Oct 2013.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: LISTERIA MONOCYTOGENES EGD-E, HOMO SAPIENS
Chains: 6
Atoms: 8,424
Mol. weight: 113.9 kDa
Ligands: PE4, PO4
Released: 30 Oct 2013

Explore 4CC4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4CC4 contains 37 α-helices and 92 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	41-42	2	1
α-helix	43-46	4
α-helix	50-60	11
β-strand	68-69	2	1
α-helix	71-75	5
β-strand	79-81	3	2
α-helix	93-95	3
β-strand	101-103	3	2
α-helix	113-115	3
β-strand	123-125	3	2
β-strand	144-146	3	2
β-strand	154	1	3
α-helix	156-158	3
β-strand	166-168	3	2
β-strand	176	1	3
α-helix	178-182	5
β-strand	188-190	3	2
β-strand	198	1	4
α-helix	202-204	3
β-strand	210-212	3	2
β-strand	213-219	7	5
β-strand	228-232	5	6
β-strand	236	1	4
α-helix	241	1
β-strand	242	1	4
α-helix	243-245	3
β-strand	247-248	2	5
α-helix	249-251	3
β-strand	253-255	3	6
β-strand	258-262	5	6
β-strand	269-280	12	5
β-strand	283-294	12	5

Chain B: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	1517-1520	4	7
β-strand	1524	1	8
β-strand	1531	1	9
α-helix	1532-1533	2
β-strand	1534	1	8
β-strand	1539-1540	2	7
β-strand	1541-1544	4	9
β-strand	1554-1559	6	9
β-strand	1562-1567	6	9
α-helix	1568-1570	3
β-strand	1571-1574	4	7

Chain C: 12 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	41-42	2	10
α-helix	43-46	4
α-helix	50-59	10
β-strand	68-69	2	10
α-helix	71-75	5
β-strand	79-81	3	11
α-helix	93-95	3
β-strand	101-103	3	11
α-helix	113-115	3
β-strand	123-125	3	11
β-strand	144-146	3	11
β-strand	154	1	12
α-helix	156-158	3
β-strand	166-168	3	11
β-strand	176	1	12
α-helix	180-182	3
β-strand	188-190	3	11
β-strand	198	1	13
α-helix	202-204	3
β-strand	210-212	3	11
β-strand	213-219	7	14
α-helix	220-222	3
β-strand	223-224	2	15
β-strand	228-232	5	16
β-strand	236	1	13
α-helix	241	1
β-strand	242	1	13
α-helix	243-245	3
β-strand	247-248	2	14
α-helix	249-251	3
β-strand	253-255	3	16
β-strand	258-262	5	16
β-strand	269-280	12	14
β-strand	283-294	12	14
β-strand	295-296	2	15

Chain D: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	1518-1520	3	17
β-strand	1524	1	18
β-strand	1531	1	19
β-strand	1534	1	18
β-strand	1538-1540	3	17
β-strand	1541-1544	4	19
β-strand	1554-1558	5	19
β-strand	1563-1567	5	19
α-helix	1568-1570	3
β-strand	1571-1573	3	17

Chain E: 10 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	41-42	2	20
α-helix	43-46	4
α-helix	50-59	10
β-strand	68-69	2	20
α-helix	71-76	6
β-strand	79-81	3	21
α-helix	93-95	3
β-strand	101-103	3	21
α-helix	113-115	3
β-strand	123-125	3	21
β-strand	144-146	3	21
α-helix	156-158	3
β-strand	166-168	3	21
α-helix	178-182	5
β-strand	188-190	3	21
β-strand	198	1	22
α-helix	200-204	5
β-strand	210-212	3	21
β-strand	213-219	7	23
β-strand	223	1	24
β-strand	229-232	4	25
β-strand	236	1	22
α-helix	241	1
β-strand	242	1	22
α-helix	243-245	3
β-strand	247-248	2	23
β-strand	253-255	3	25
β-strand	258-261	4	25
β-strand	269-280	12	23
β-strand	283-294	12	23
β-strand	295	1	24

Chain F: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	1518-1520	3	26
β-strand	1524	1	27
β-strand	1531	1	28
β-strand	1534	1	27
β-strand	1539-1540	2	26
β-strand	1541-1544	4	28
β-strand	1554-1559	6	28
β-strand	1562-1567	6	28
α-helix	1568-1570	3
β-strand	1571-1573	3	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Inlc protein	A, E	protein	266	LISTERIA MONOCYTOGENES EGD-E	P71451 (AlphaFold model)
Dynamin-binding protein	B, D, F	protein	68	HOMO SAPIENS	Q6XZF7 (AlphaFold model)
Inlc protein	C	protein	266	LISTERIA MONOCYTOGENES EGD-E	P71451 (AlphaFold model)

Sequence of entity 1 (A, E), FASTA

>4CC4_1 INLC PROTEIN (chains A, E)
ASESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAG
MQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSACLSRLFLDNNEL
RDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWID
LTGQKCVNEPVKYQPELYITNTVKDPDGRWISPAAISNGGSYVDGCVLWELPVYTDEVSY
KFSEYINVGETEAIFDGTVTQPIKNK

Sequence of entity 2 (B, D, F), FASTA

>4CC4_2 DYNAMIN-BINDING PROTEIN (chains B, D, F)
GPEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNY
IRKTEYTA

Sequence of entity 3 (C), FASTA

>4CC4_3 INLC PROTEIN (chains C)
ASESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAG
MQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSACLSRLFLDNNEL
RDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWID
LTGQKCVNEPVKYQPELYITNTVKDPDGRWISPAAISNGGSYVDGCVLWELPVYTDEVSY
KFSEYINVGETEAIFDGTVTQPIKNK

Ligands and cofactors

ID	Name	Formula	Copies
PE4	2-{2-[2-(2-{2-[2-(2-ethoxy-ethoxy)-ethoxy]-ethoxy}-ethoxy)-ethoxy]-ethoxy}-etha…	C16 H34 O8	1
PO4	Phosphate ion	O4 P	2

Water and common crystallization additives (SO4, CL, GOL) are not listed.

Primary citation

Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading. Polle, L., Rigano, L.A., Julian, R. et al. Structure (2014) 22:304. DOI 10.1016/J.STR.2013.10.017 · PubMed

Other PDB entries of the same protein (UniProt P71451 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9TMK 1.8 Å, Structure of CYLD CAP-Gly2 bound to Listeria effector protein InlC
1XEU 2.05 Å, Crystal Structure of Internalin C from Listeria monocytogenes

Browse structure collections

About this viewer

MolViewer shows 4CC4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.