4CEK: Regulator of nonsense transcripts 2

Crystal structure of the second MIF4G domain of human nonsense mediated decay factor UPF2. Determined by X-ray diffraction at 2.35 Å resolution. Released 11 Dec 2013.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,990
Mol. weight: 35.61 kDa
Released: 11 Dec 2013

Explore 4CEK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4CEK contains 15 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	463-469	7
α-helix	474-476	3
α-helix	536-546	11
α-helix	560-574	15
α-helix	575-577	3
α-helix	581-594	14
α-helix	598-609	12
α-helix	613-618	6
α-helix	619-629	11
α-helix	635-653	19
α-helix	660-675	16
α-helix	681-693	13
α-helix	697-716	20
α-helix	718-737	20
α-helix	742-755	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulator of nonsense transcripts 2	A	protein	307	HOMO SAPIENS	Q9HAU5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4CEK_1 REGULATOR OF NONSENSE TRANSCRIPTS 2 (chains A)
GAMGEGGIWEDEDARNFYENLIDLKAFVPAILFKDNEKSCQNKESNKDDTKEAKESKENK
EVSSPDDLELELENLEINDDTLELEGGDEAEDLTKKLLDEQEQEDEEASTGSHLKLIVDA
FLQQLPNCVNRDLIDKAAMDFCMNMNTKANRKKLVRALFIVPRQRLDLLPFYARLVATLH
PCMSDVAEDLCSMLRGDFRFHVRKKDQINIETKNKTVRFIGELTKFKMFTKNDTLHCLKM
LLSDFSHHHIEMACTLLETCGRFLFRSPESHLRTSVLLEQMMRKKQAMHLDARYVTMVEN
AYYYCNP

Primary citation

Structural and Functional Analysis of the Three Mif4G Domains of Nonsense-Mediated Decay Factor Upf2. Clerici, M., Deniaud, A., Boehm, V. et al. Nucleic Acids Res (2014) 42:2673. DOI 10.1093/NAR/GKT1197 · PubMed

Other PDB entries of the same protein (UniProt Q9HAU5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UW4 1.95 Å, The structural basis of the interaction between nonsense mediated decay factors UPF2 and…
4CEM 2.6 Å, Crystal structure of the first MIF4G domain of human nonsense mediated decay factor UPF2
7NWU 2.6 Å, Co-crystal structure of UPF3B-RRM-NOPS-L with UPF2-MIF4GIII
2WJV 2.85 Å, Crystal structure of the complex between human nonsense mediated decay factors UPF1 and…
7QG6 2.95 Å, Co-crystal structure of UPF3A-RRM-NOPS-L with UPF2-MIF4GIII

Browse structure collections

About this viewer

MolViewer shows 4CEK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.