4CEM: Regulator of nonsense transcripts 2

Crystal structure of the first MIF4G domain of human nonsense mediated decay factor UPF2. Determined by X-ray diffraction at 2.6 Å resolution. Released 11 Dec 2013.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 5,115
Mol. weight: 85.93 kDa
Released: 11 Dec 2013

Explore 4CEM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4CEM contains 40 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	122-149	28
α-helix	152-154	3
α-helix	158-162	5
β-strand	165	1	1
α-helix	168-177	10
α-helix	178-180	3
α-helix	183-185	3
α-helix	186-195	10
β-strand	196	1	1
α-helix	202-211	10
α-helix	216-218	3
α-helix	219-232	14
α-helix	236-253	18
α-helix	259-274	16
α-helix	280-297	18
α-helix	305-320	16
α-helix	325-334	10
α-helix	338-340	3
α-helix	346-375	30
α-helix	383-386	4
α-helix	399-419	21
α-helix	422-426	5

Chain B: 20 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	122-149	28
α-helix	152-154	3
α-helix	155-157	3
α-helix	158-161	4
β-strand	165	1	2
α-helix	168-177	10
α-helix	178-180	3
α-helix	183-185	3
α-helix	186-195	10
β-strand	196	1	2
α-helix	202-211	10
α-helix	216-218	3
α-helix	219-232	14
α-helix	236-252	17
α-helix	259-274	16
α-helix	280-297	18
α-helix	305-319	15
α-helix	325-334	10
α-helix	338-340	3
α-helix	346-383	38
α-helix	395-419	25
α-helix	423-426	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulator of nonsense transcripts 2	A, B	protein	370	HOMO SAPIENS	Q9HAU5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4CEM_1 REGULATOR OF NONSENSE TRANSCRIPTS 2 (chains A, B)
GAMGMKEKEESIQLHQEAWERHHLRKELRSKNQNAPDSRPEENFFSRLDSSIKKNTAFVK
KLKTITEQQRDSLSHDFNGLNLSKYIAEAVASIVEAKLKISDVNCAVHLCSLFHQRYADF
APSLLQVWKKHFEARKEEKTPNITKLRTDLRFIAELTIVGIFTDKEGLSLIYEQLKNIIN
ADRESHTHVSVVISFCRHCGDDIAGLVPRKVKSAAEKFNLSFPPSEIISPEKQQPFQNLL
KEYFTSLTKHLKRDHRELQNTERQNRRILHSKGELSEDRHKQYEEFAMSYQKLLANSQSL
ADLLDENMPDLPQDKPTPEEHGPGIDIFTPGKPGEYDLEGGIWEDEDARNFYENLIDLKA
FVPAILFKDN

Primary citation

Structural and Functional Analysis of the Three Mif4G Domains of Nonsense-Mediated Decay Factor Upf2. Clerici, M., Deniaud, A., Boehm, V. et al. Nucleic Acids Res (2014) 42:2673. DOI 10.1093/NAR/GKT1197 · PubMed

Other PDB entries of the same protein (UniProt Q9HAU5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UW4 1.95 Å, The structural basis of the interaction between nonsense mediated decay factors UPF2 and…
4CEK 2.35 Å, Crystal structure of the second MIF4G domain of human nonsense mediated decay factor UPF2
7NWU 2.6 Å, Co-crystal structure of UPF3B-RRM-NOPS-L with UPF2-MIF4GIII
2WJV 2.85 Å, Crystal structure of the complex between human nonsense mediated decay factors UPF1 and…
7QG6 2.95 Å, Co-crystal structure of UPF3A-RRM-NOPS-L with UPF2-MIF4GIII

Browse structure collections

About this viewer

MolViewer shows 4CEM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.