4CIM: Complex of a Bcl-w BH3 mutant with a BH3 domain

Complex of a Bcl-w BH3 mutant with a BH3 domain. Determined by X-ray diffraction at 1.5 Å resolution. Released 12 Nov 2014.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 3,003
Mol. weight: 41.27 kDa
Released: 12 Nov 2014

Explore 4CIM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4CIM contains 20 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	10-24	15
α-helix	41-60	20
α-helix	65-67	3
α-helix	75-86	12
α-helix	93-112	20
α-helix	117-129	13
α-helix	130-134	5
α-helix	135-140	6
α-helix	144-151	8

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	10-24	15
α-helix	41-60	20
α-helix	64-66	3
α-helix	75-86	12
α-helix	93-112	20
α-helix	117-129	13
α-helix	130-134	5
α-helix	135-140	6
α-helix	144-151	8

Chains P and Q: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	41-56	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-2-like protein 2	A, B	protein	163	HOMO SAPIENS	Q92843 (AlphaFold model)
Bcl-2-like protein 2	P, Q	protein	21	HOMO SAPIENS	Q92843 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4CIM_1 BCL-2-LIKE PROTEIN 2 (chains A, B)
MATPASAPDTRALVADFVGYKLRQKGYVSGAGPGEGPAADPLGQALRAIGDEFETRFRRT
FSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG
QVQEWMVEYLETRLADWIHSSGGWAEFTALYGDGALEEARRLR

Sequence of entity 2 (P, Q), FASTA

>4CIM_2 BCL-2-LIKE PROTEIN 2 (chains P, Q)
AADPLGQALRAIGDEFETRFR

Primary citation

The Functional Differences of Pro-Survival and Pro-Apoptotic B Cell Lymphoma 2 (Bcl-2) Proteins Depend on Structural Differences in Their Bcl-2 Homology 3 (Bh3) Domains. Lee, E.F., Dewson, G., Evangelista, M. et al. J Biol Chem (2014) 289:36001. DOI 10.1074/JBC.M114.610758 · PubMed

Other PDB entries of the same protein (UniProt Q92843 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Y6W 2.0 Å, Structure of a Bcl-w dimer
1MK3 Solution structure of human bcl-W protein
1O0L The structure of bcl-W reveals a role for the C-terminal residues in modulating…
1ZY3 Structural model of complex of Bcl-w protein with Bid BH3-peptide

Browse structure collections

About this viewer

MolViewer shows 4CIM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.