Crystal structure of OCRL in complex with a phosphate ion. Determined by X-ray diffraction at 3.13 Å resolution. Released 16 Apr 2014.
Explore 4CMN in 3D Show helices and sheets RCSB PDB PDBe
4CMN contains 20 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 222-229 | 8 | |
| α-helix | 231-234 | 4 | |
| β-strand | 235-248 | 14 | 1 |
| α-helix | 252-254 | 3 | |
| α-helix | 259-262 | 4 | |
| α-helix | 268-269 | 2 | |
| β-strand | 271-277 | 7 | 1 |
| α-helix | 283-286 | 4 | |
| α-helix | 292-304 | 13 | |
| β-strand | 311-319 | 9 | 1 |
| β-strand | 322-329 | 8 | 1 |
| α-helix | 332-335 | 4 | |
| β-strand | 336-345 | 10 | 2 |
| α-helix | 348-350 | 3 | |
| β-strand | 356-364 | 9 | 2 |
| β-strand | 367-375 | 9 | 2 |
| α-helix | 383-396 | 14 | |
| β-strand | 398-399 | 2 | 3 |
| α-helix | 407-408 | 2 | |
| β-strand | 409-410 | 2 | 3 |
| α-helix | 411-413 | 3 | |
| β-strand | 416-422 | 7 | 2 |
| β-strand | 427 | 1 | 4 |
| α-helix | 432-440 | 9 | |
| α-helix | 444-448 | 5 | |
| β-strand | 451 | 1 | 4 |
| α-helix | 452-458 | 7 | |
| β-strand | 467-468 | 2 | 2 |
| β-strand | 477 | 1 | 5 |
| β-strand | 479 | 1 | 6 |
| β-strand | 486 | 1 | 6 |
| α-helix | 487 | 1 | |
| α-helix | 493-495 | 3 | |
| β-strand | 496 | 1 | 5 |
| β-strand | 499-504 | 6 | 2 |
| β-strand | 508-510 | 3 | 1 |
| β-strand | 514-515 | 2 | 1 |
| α-helix | 525-526 | 2 | |
| β-strand | 527-538 | 12 | 1 |
| α-helix | 539 | 1 | |
| α-helix | 540-556 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Inositol polyphosphate 5-phosphatase ocrl-1 | A | protein | 354 | HOMO SAPIENS | Q01968 (AlphaFold model) |
>4CMN_1 INOSITOL POLYPHOSPHATE 5-PHOSPHATASE OCRL-1 (chains A) MQSGQREGLIKHILAKREKEYVNIQTFRFFVGTWNVNGQSPDSGLEPWLNCDPNPPDIYC IGFQELDLSTEAFFYFESVKEQEWSMAVERGLHSKAKYKKVQLVRLVGMMLLIFARKDQC RYIRDIATETVGTGIMGKMGNKGGVAVRFVFHNTTFCIVNSHLAAHVEDFERRNQDYKDI CARMSFVVPNQTLPQLNIMKHEVVIWLGDLNYRLGMPDANEVKSLINKKDLQRLLKFDQL NIQRTQKKAFVDFNEGEIKFIPTYKYDSKTDRWDSSGKCRVPAWCDRILWRGTNVNQLNY RSHMELKTSDHKPVSALFHIGVKVVDERRYRKVFEDSVRIMDRMENDAHHHHHH
Water and common crystallization additives (GOL) are not listed.
Structural Basis for Phosphoinositide Substrate Recognition, Catalysis, and Membrane Interactions in Human Inositol Polyphosphate 5-Phosphatases. Tresaugues, L., Silvander, C., Flodin, S. et al. Structure (2014) 22:744. DOI 10.1016/J.STR.2014.01.013 · PubMed
Other PDB entries of the same protein (UniProt Q01968 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4CMN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.