4DJ2: Period circadian protein homolog 1

Unwinding the Differences of the Mammalian PERIOD Clock Proteins from Crystal Structure to Cellular Function. Determined by X-ray diffraction at 2.75 Å resolution. Released 29 Feb 2012.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: Mus musculus
Chains: 4
Atoms: 8,170
Mol. weight: 143.01 kDa
Released: 29 Feb 2012

Explore 4DJ2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4DJ2 contains 55 α-helices and 74 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	199-200	2	1
α-helix	202-212	11
β-strand	219-225	7	1
β-strand	230	1	2
β-strand	231-234	4	1
α-helix	237-242	6
β-strand	253	1	2
α-helix	254-257	4
β-strand	258	1	1
α-helix	260-269	10
α-helix	275-276	2
β-strand	277	1	1
β-strand	297-301	5	1
β-strand	314-325	12	1
β-strand	334-343	10	1
α-helix	352-354	3
α-helix	355-357	3
β-strand	359-364	6	3
β-strand	369	1	4
β-strand	370-373	4	3
α-helix	377-381	5
α-helix	385-388	4
β-strand	392	1	4
α-helix	393-396	4
β-strand	397	1	3
α-helix	399-401	3
α-helix	402-412	11
β-strand	420-421	2	3
β-strand	425-428	4	3
β-strand	434-438	5	3
β-strand	440-445	6	3
β-strand	452-461	10	3
α-helix	485-498	14

Chain B: 12 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	199-201	3	5
α-helix	204-215	12
β-strand	219-225	7	5
β-strand	230	1	6
β-strand	231-234	4	5
α-helix	237-242	6
β-strand	253	1	6
α-helix	254-257	4
β-strand	258	1	5
α-helix	263-269	7
α-helix	275-276	2
β-strand	277	1	5
β-strand	297-301	5	5
β-strand	314-326	13	5
β-strand	334-343	10	5
α-helix	355-357	3
β-strand	359-364	6	7
β-strand	369	1	8
β-strand	370-373	4	7
α-helix	377-381	5
α-helix	385-388	4
β-strand	392	1	8
α-helix	393-396	4
β-strand	397	1	7
α-helix	399-401	3
α-helix	402-415	14
β-strand	420-428	9	7
β-strand	434-441	8	7
β-strand	444-445	2	9
β-strand	452-454	3	9
β-strand	455-461	7	7
α-helix	486-497	12

Chain C: 15 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	219-224	6	10
β-strand	231-234	4	10
α-helix	237-242	6
α-helix	246-248	3
α-helix	254-256	3
β-strand	258	1	10
α-helix	260-269	10
α-helix	272-274	3
α-helix	275-276	2
β-strand	277	1	11
α-helix	278	1
β-strand	297-301	5	10
β-strand	314-321	8	10
β-strand	322	1	11
β-strand	338-343	6	10
α-helix	352-354	3
β-strand	359-364	6	12
β-strand	369	1	13
β-strand	370-373	4	12
α-helix	377-381	5
α-helix	385-388	4
β-strand	392	1	13
α-helix	393-396	4
β-strand	397	1	12
α-helix	399-401	3
α-helix	404-413	10
β-strand	420-428	9	12
α-helix	429	1
β-strand	434-441	8	12
β-strand	444-445	2	14
β-strand	452-454	3	14
β-strand	455-461	7	12
α-helix	485-497	13

Chain D: 15 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	219-223	5	15
β-strand	233-234	2	15
α-helix	238-241	4
α-helix	246-248	3
β-strand	258	1	15
α-helix	260-269	10
α-helix	275-277	3
β-strand	297-302	6	15
β-strand	313-321	9	15
β-strand	338-343	6	15
α-helix	344	1
α-helix	352-354	3
α-helix	355-357	3
β-strand	359-364	6	16
β-strand	369	1	17
β-strand	370-373	4	16
α-helix	377-381	5
α-helix	385-388	4
β-strand	392	1	17
α-helix	393-396	4
β-strand	397	1	16
α-helix	399-401	3
α-helix	404-414	11
β-strand	420-428	9	16
β-strand	434-441	8	16
β-strand	444-445	2	18
β-strand	452-454	3	18
β-strand	455-463	9	16
α-helix	464-465	2
α-helix	485-497	13
α-helix	500-501	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Period circadian protein homolog 1	A, B, C, D	protein	320	Mus musculus	O35973 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4DJ2_1 Period circadian protein homolog 1 (chains A, B, C, D)
GPLGSPEFEPCAMDMSTYTLEELEHITSEYTLRNQDTFSVAVSFLTGRIVYISEQAGVLL
RCKRDVFRGARFSELLAPQDVGVFYGSTTPSRLPTWGTGTSAGSGLKDFTQEKSVFCRIR
GGPDRDPGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEAPRIPPDKRIFTT
RHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPFDH
SPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPSPAPSL
DSDIQELSEQIHRLLLQPVH

Primary citation

Unwinding the differences of the mammalian PERIOD clock proteins from crystal structure to cellular function. Kucera, N., Schmalen, I., Hennig, S. et al. Proc Natl Acad Sci U S A (2012) 109:3311-3316. DOI 10.1073/pnas.1113280109 · PubMed

Other PDB entries of the same protein (UniProt O35973 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SLO 1.7 Å, WD repeat containing protein 5 (WDR5)- PER1 peptide

Browse structure collections

About this viewer

MolViewer shows 4DJ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.